DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2Av and HTZ1

DIOPT Version :9

Sequence 1:NP_001262997.1 Gene:His2Av / 43229 FlyBaseID:FBgn0001197 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_014631.1 Gene:HTZ1 / 854150 SGDID:S000005372 Length:134 Species:Saccharomyces cerevisiae


Alignment Length:122 Identity:87/122 - (71%)
Similarity:103/122 - (84%) Gaps:3/122 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GKAG-KDSGKAKAKAVSRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVL 67
            ||:| ||||..:::  |.|||||||||||||.|:||...|...|||:.||:|..|:|||||||||
Yeast    10 GKSGAKDSGSLRSQ--SSSARAGLQFPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVL 72

  Fly    68 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKEE 124
            ||||||:||||||||||||||||||||:||||||:||||.|||:|||:|:|:.|.|:
Yeast    73 ELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLIRATIASGGVLPHINKALLLKVEK 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2AvNP_001262997.1 PLN00154 6..121 CDD:177756 83/115 (72%)
HTZ1NP_014631.1 PTZ00017 7..134 CDD:185399 87/122 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 119 1.000 Domainoid score I1278
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H83271
Inparanoid 1 1.050 165 1.000 Inparanoid score I1043
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoFinder 1 1.000 - - FOG0001705
OrthoInspector 1 1.000 - - oto99441
orthoMCL 1 0.900 - - OOG6_101774
Panther 1 1.100 - - LDO PTHR23430
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R542
SonicParanoid 1 1.000 - - X1100
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.