DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2Av and HTA1

DIOPT Version :9

Sequence 1:NP_001262997.1 Gene:His2Av / 43229 FlyBaseID:FBgn0001197 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_010511.3 Gene:HTA1 / 851811 SGDID:S000002633 Length:132 Species:Saccharomyces cerevisiae


Alignment Length:123 Identity:73/123 - (59%)
Similarity:92/123 - (74%) Gaps:3/123 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGGKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAE 65
            |:|||.||....||| :.||||:|||.|||||:||.|: |.....|:|:.|.||..|:||||.||
Yeast     1 MSGGKGGKAGSAAKA-SQSRSAKAGLTFPVGRVHRLLR-RGNYAQRIGSGAPVYLTAVLEYLAAE 63

  Fly    66 VLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLI-KATIAGGGVIPHIHKSLIGKK 122
            :|||||||::|.|..||.|||||||||.|:||:.|: ..|||.|||:|:||::|:.||
Yeast    64 ILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKK 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2AvNP_001262997.1 PLN00154 6..121 CDD:177756 67/115 (58%)
HTA1NP_010511.3 PTZ00017 18..131 CDD:185399 64/105 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.