DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2Av and HTA7

DIOPT Version :10

Sequence 1:NP_524519.1 Gene:His2Av / 43229 FlyBaseID:FBgn0001197 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_198119.1 Gene:HTA7 / 832829 AraportID:AT5G27670 Length:150 Species:Arabidopsis thaliana


Alignment Length:138 Identity:73/138 - (52%)
Similarity:90/138 - (65%) Gaps:6/138 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AGGKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEV 66
            |||:.|.|    :.|:||:|.:||||||||||.|:||....:. |.|:.|.||.||:||||.|||
plant    14 AGGRKGGD----RKKSVSKSVKAGLQFPVGRIARYLKKGRYAL-RYGSGAPVYLAAVLEYLAAEV 73

  Fly    67 LELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKKEETVQDPQ 130
            |||||||::|.|..||.||||.||||.||||..|:. .|||.|||:|:|:..|:.||........
plant    74 LELAGNAARDNKKNRINPRHLCLAIRNDEELGRLLHGVTIASGGVLPNINPVLLPKKSTASSSQA 138

  Fly   131 RKGNVILS 138
            .|.:...|
plant   139 EKASATKS 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2AvNP_524519.1 PLN00154 6..121 CDD:177756 66/115 (57%)
HTA7NP_198119.1 PTZ00017 12..140 CDD:185399 71/130 (55%)

Return to query results.
Submit another query.