DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2Av and HTA11

DIOPT Version :9

Sequence 1:NP_001262997.1 Gene:His2Av / 43229 FlyBaseID:FBgn0001197 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001325682.1 Gene:HTA11 / 824621 AraportID:AT3G54560 Length:136 Species:Arabidopsis thaliana


Alignment Length:128 Identity:101/128 - (78%)
Similarity:109/128 - (85%) Gaps:9/128 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GGK---------AGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAI 58
            |||         |.||..|.|.|.:|||||||:|||||||||.||:|.::|||||||||||:|:|
plant     5 GGKGLVAAKTMAANKDKDKDKKKPISRSARAGIQFPVGRIHRQLKTRVSAHGRVGATAAVYTASI 69

  Fly    59 LEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGK 121
            ||||||||||||||||||||||||||||||||||||||||:|||.||||||||||||||||.|
plant    70 LEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2AvNP_001262997.1 PLN00154 6..121 CDD:177756 97/114 (85%)
HTA11NP_001325682.1 PLN00154 1..136 CDD:177756 101/128 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 146 1.000 Domainoid score I1463
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H83271
Inparanoid 1 1.050 195 1.000 Inparanoid score I1347
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001705
OrthoInspector 1 1.000 - - otm2586
orthoMCL 1 0.900 - - OOG6_101774
Panther 1 1.100 - - LDO PTHR23430
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1100
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.