DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2Av and H2az2

DIOPT Version :9

Sequence 1:NP_001262997.1 Gene:His2Av / 43229 FlyBaseID:FBgn0001197 Length:141 Species:Drosophila melanogaster
Sequence 2:XP_030102286.1 Gene:H2az2 / 77605 MGIID:1924855 Length:131 Species:Mus musculus


Alignment Length:120 Identity:99/120 - (82%)
Similarity:101/120 - (84%) Gaps:14/120 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AVSRSARAG--------------LQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVL 67
            |.:.|||.|              ..|||||||||||:||||||||||||||||||||||||||||
Mouse     6 ACTYSARGGQTRESDILELDSHMCHFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVL 70

  Fly    68 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 122
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse    71 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2AvNP_001262997.1 PLN00154 6..121 CDD:177756 96/117 (82%)
H2az2XP_030102286.1 PLN00154 <30..124 CDD:177756 91/93 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842746
Domainoid 1 1.000 168 1.000 Domainoid score I3820
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H83271
Inparanoid 1 1.050 234 1.000 Inparanoid score I3401
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoDB 1 1.010 - - D590211at33208
OrthoFinder 1 1.000 - - FOG0001705
OrthoInspector 1 1.000 - - otm43129
orthoMCL 1 0.900 - - OOG6_101774
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R542
SonicParanoid 1 1.000 - - X1100
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.700

Return to query results.
Submit another query.