DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2Av and LOC689408

DIOPT Version :9

Sequence 1:NP_001262997.1 Gene:His2Av / 43229 FlyBaseID:FBgn0001197 Length:141 Species:Drosophila melanogaster
Sequence 2:XP_001070681.5 Gene:LOC689408 / 689408 RGDID:1592352 Length:157 Species:Rattus norvegicus


Alignment Length:122 Identity:115/122 - (94%)
Similarity:117/122 - (95%) Gaps:0/122 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGGKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAE 65
            |||||||||:|||||||||||.||||||||||||||||:|.||.|||||||||||||||||||||
  Rat    30 MAGGKAGKDNGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRATSRGRVGATAAVYSAAILEYLTAE 94

  Fly    66 VLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 122
            |||||||||||||||||||.||||||||||||||||.||||||||||||||||||||
  Rat    95 VLELAGNASKDLKVKRITPSHLQLAIRGDEELDSLINATIAGGGVIPHIHKSLIGKK 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2AvNP_001262997.1 PLN00154 6..121 CDD:177756 107/114 (94%)
LOC689408XP_001070681.5 PLN00154 19..150 CDD:177756 112/119 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D590211at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.