DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2Av and H2az2

DIOPT Version :9

Sequence 1:NP_001262997.1 Gene:His2Av / 43229 FlyBaseID:FBgn0001197 Length:141 Species:Drosophila melanogaster
Sequence 2:XP_006251449.1 Gene:H2az2 / 685909 RGDID:1587865 Length:143 Species:Rattus norvegicus


Alignment Length:121 Identity:119/121 - (98%)
Similarity:120/121 - (99%) Gaps:0/121 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AGGKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEV 66
            ||||||||||||||||||||.||||||||||||||||:|||||||||||||||||||||||||||
  Rat    17 AGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEV 81

  Fly    67 LELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 122
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat    82 LELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2AvNP_001262997.1 PLN00154 6..121 CDD:177756 112/114 (98%)
H2az2XP_006251449.1 PLN00154 8..136 CDD:177756 116/118 (98%)
H2A 23..137 CDD:238029 111/113 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346214
Domainoid 1 1.000 168 1.000 Domainoid score I3729
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H83271
Inparanoid 1 1.050 234 1.000 Inparanoid score I3325
OMA 1 1.010 - - QHG53554
OrthoDB 1 1.010 - - D590211at33208
OrthoFinder 1 1.000 - - FOG0001705
OrthoInspector 1 1.000 - - otm45197
orthoMCL 1 0.900 - - OOG6_101774
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1100
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.810

Return to query results.
Submit another query.