DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2Av and Macroh2a2

DIOPT Version :10

Sequence 1:NP_524519.1 Gene:His2Av / 43229 FlyBaseID:FBgn0001197 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_996883.1 Gene:Macroh2a2 / 404634 MGIID:3037658 Length:372 Species:Mus musculus


Alignment Length:130 Identity:70/130 - (53%)
Similarity:88/130 - (67%) Gaps:6/130 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SGKAKAKAVSRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNAS 74
            |||.|...:|||||||:.|||||:.|:||..|..: |:...|.||.||::|||.||:|||||||:
Mouse     5 SGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKY-RISVGAPVYMAAVIEYLAAEILELAGNAA 68

  Fly    75 KDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKKEETVQDPQRKGNVILS 138
            :|.|..||.|||:.||:..||||:.|:| .|||.|||:|.||..|:.||..|    :.|...|||
Mouse    69 RDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGT----KGKSETILS 129

  Fly   139  138
            Mouse   130  129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2AvNP_524519.1 PLN00154 6..121 CDD:177756 63/111 (57%)
Macroh2a2NP_996883.1 H2A 14..119 CDD:197711 61/105 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..182 7/20 (35%)
Macro_H2A-like 178..368 CDD:394875
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.