DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2Av and Macroh2a2

DIOPT Version :9

Sequence 1:NP_001262997.1 Gene:His2Av / 43229 FlyBaseID:FBgn0001197 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001129279.1 Gene:Macroh2a2 / 361844 RGDID:1561371 Length:372 Species:Rattus norvegicus


Alignment Length:130 Identity:70/130 - (53%)
Similarity:88/130 - (67%) Gaps:6/130 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SGKAKAKAVSRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNAS 74
            |||.|...:|||||||:.|||||:.|:||..|..: |:...|.||.||::|||.||:|||||||:
  Rat     5 SGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKY-RISVGAPVYMAAVIEYLAAEILELAGNAA 68

  Fly    75 KDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKKEETVQDPQRKGNVILS 138
            :|.|..||.|||:.||:..||||:.|:| .|||.|||:|.||..|:.||..|    :.|...|||
  Rat    69 RDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGT----KGKSETILS 129

  Fly   139  138
              Rat   130  129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2AvNP_001262997.1 PLN00154 6..121 CDD:177756 63/111 (57%)
Macroh2a2NP_001129279.1 H2A 5..117 CDD:238029 63/112 (56%)
Macro_H2A-like 178..368 CDD:394875
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.