DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2Av and pht1

DIOPT Version :9

Sequence 1:NP_001262997.1 Gene:His2Av / 43229 FlyBaseID:FBgn0001197 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_595630.3 Gene:pht1 / 2539668 PomBaseID:SPBC11B10.10c Length:139 Species:Schizosaccharomyces pombe


Alignment Length:130 Identity:90/130 - (69%)
Similarity:108/130 - (83%) Gaps:6/130 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGGKAGKD-SGKAKAK-----AVSRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAIL 59
            |:||..||. .||..:|     .:|.||||||||||||:.|.||::|.::.||||.:||||||:|
pombe     1 MSGGGKGKHVGGKGGSKIGERGQMSHSARAGLQFPVGRVRRFLKAKTQNNMRVGAKSAVYSAAVL 65

  Fly    60 EYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKEE 124
            ||||||||||||||:||||||||||||||||||||||||:||:||||||||:|||:|.|:.:.:|
pombe    66 EYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDEELDTLIRATIAGGGVLPHINKQLLIRTKE 130

  Fly   125  124
            pombe   131  130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2AvNP_001262997.1 PLN00154 6..121 CDD:177756 86/120 (72%)
pht1NP_595630.3 HTA1 18..139 CDD:227587 82/113 (73%)
H2A 25..127 CDD:238029 81/101 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1417
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H83271
Inparanoid 1 1.050 168 1.000 Inparanoid score I1199
OMA 1 1.010 - - QHG53554
OrthoFinder 1 1.000 - - FOG0001705
OrthoInspector 1 1.000 - - oto101040
orthoMCL 1 0.900 - - OOG6_101774
Panther 1 1.100 - - LDO PTHR23430
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R542
SonicParanoid 1 1.000 - - X1100
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.