DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2Av and h2az2a

DIOPT Version :9

Sequence 1:NP_001262997.1 Gene:His2Av / 43229 FlyBaseID:FBgn0001197 Length:141 Species:Drosophila melanogaster
Sequence 2:XP_005165093.1 Gene:h2az2a / 252913 ZFINID:ZDB-GENE-020717-1 Length:137 Species:Danio rerio


Alignment Length:110 Identity:107/110 - (97%)
Similarity:109/110 - (99%) Gaps:0/110 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGGKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAE 65
            |||||||||||||||||||||.||||||||||||||||:||||||||||||||||||||||||||
Zfish     1 MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAE 65

  Fly    66 VLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGV 110
            ||||||||||||||||||||||||||||||||||||||||||||:
Zfish    66 VLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGM 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2AvNP_001262997.1 PLN00154 6..121 CDD:177756 102/105 (97%)
h2az2aXP_005165093.1 H2A 8..109 CDD:238029 98/100 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587180
Domainoid 1 1.000 168 1.000 Domainoid score I3794
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H83271
Inparanoid 1 1.050 234 1.000 Inparanoid score I3379
OMA 1 1.010 - - QHG53554
OrthoDB 1 1.010 - - D590211at33208
OrthoFinder 1 1.000 - - FOG0001705
OrthoInspector 1 1.000 - - otm26346
orthoMCL 1 0.900 - - OOG6_101774
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R542
SonicParanoid 1 1.000 - - X1100
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.700

Return to query results.
Submit another query.