DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2Av and htz-1

DIOPT Version :9

Sequence 1:NP_001262997.1 Gene:His2Av / 43229 FlyBaseID:FBgn0001197 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_500569.1 Gene:htz-1 / 177212 WormBaseID:WBGene00019947 Length:140 Species:Caenorhabditis elegans


Alignment Length:140 Identity:114/140 - (81%)
Similarity:119/140 - (85%) Gaps:10/140 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAG--GKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLT 63
            |||  |||||||||:|:|.||||||||||||||||||.||.||||.|||||||||||||||||||
 Worm     1 MAGGKGKAGKDSGKSKSKVVSRSARAGLQFPVGRIHRFLKQRTTSSGRVGATAAVYSAAILEYLT 65

  Fly    64 AEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKEETV-- 126
            ||||||||||||||||||||||||.||||||||||:||||||||||||||||:.|:.||...|  
 Worm    66 AEVLELAGNASKDLKVKRITPRHLHLAIRGDEELDTLIKATIAGGGVIPHIHRYLMNKKGAPVPG 130

  Fly   127 ------QDPQ 130
                  |.||
 Worm   131 KPGAPGQGPQ 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2AvNP_001262997.1 PLN00154 6..121 CDD:177756 103/114 (90%)
htz-1NP_500569.1 PTZ00017 3..135 CDD:185399 109/131 (83%)
H2A 10..124 CDD:238029 101/113 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 157 1.000 Domainoid score I2551
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H83271
Inparanoid 1 1.050 209 1.000 Inparanoid score I2384
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoDB 1 1.010 - - D590211at33208
OrthoFinder 1 1.000 - - FOG0001705
OrthoInspector 1 1.000 - - oto18168
orthoMCL 1 0.900 - - OOG6_101774
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R542
SonicParanoid 1 1.000 - - X1100
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.810

Return to query results.
Submit another query.