DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2Av and H2ax

DIOPT Version :9

Sequence 1:NP_001262997.1 Gene:His2Av / 43229 FlyBaseID:FBgn0001197 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_034566.1 Gene:H2ax / 15270 MGIID:102688 Length:143 Species:Mus musculus


Alignment Length:131 Identity:79/131 - (60%)
Similarity:95/131 - (72%) Gaps:4/131 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGGKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAE 65
            |:|  .||..|||:|||.|||:||||||||||:||.|:....:. ||||.|.||.||:|||||||
Mouse     1 MSG--RGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAE-RVGAGAPVYLAAVLEYLTAE 62

  Fly    66 VLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLI-KATIAGGGVIPHIHKSLIGKKEETVQDP 129
            :|||||||::|.|..||.|||||||||.||||:.|: ..|||.|||:|:|...|:.||......|
Mouse    63 ILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKSSATVGP 127

  Fly   130 Q 130
            :
Mouse   128 K 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2AvNP_001262997.1 PLN00154 6..121 CDD:177756 74/115 (64%)
H2axNP_034566.1 PTZ00017 1..130 CDD:185399 79/131 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 13/22 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..143 1/8 (13%)
[ST]-Q motif 140..141
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.