DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2Av and h2ac17

DIOPT Version :9

Sequence 1:NP_001262997.1 Gene:His2Av / 43229 FlyBaseID:FBgn0001197 Length:141 Species:Drosophila melanogaster
Sequence 2:XP_012811817.1 Gene:h2ac17 / 100127770 XenbaseID:XB-GENE-5861673 Length:156 Species:Xenopus tropicalis


Alignment Length:134 Identity:71/134 - (52%)
Similarity:92/134 - (68%) Gaps:7/134 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGGKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAE 65
            |:|  .||...||.:...||||:||||||||||||.|:....:. |:|:.:|:|.||.||||.||
 Frog    19 MSG--RGKKVQKAASGKSSRSAKAGLQFPVGRIHRLLRKGNYAE-RIGSGSAIYLAATLEYLCAE 80

  Fly    66 VLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKKE---ETV 126
            ||||||||::|.|..||.|||:|||:|.|:||..|.. .|||.|||:|:|..:|:.||.   .:.
 Frog    81 VLELAGNAARDNKKSRILPRHIQLAVRNDDELAKLFDGVTIADGGVLPNIQSALLPKKTVKGSSS 145

  Fly   127 QDPQ 130
            |:|:
 Frog   146 QEPK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2AvNP_001262997.1 PLN00154 6..121 CDD:177756 65/115 (57%)
h2ac17XP_012811817.1 H2A 24..138 CDD:238029 64/114 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.