DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and Csnk1a1

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_006526446.1 Gene:Csnk1a1 / 93687 MGIID:1934950 Length:374 Species:Mus musculus


Alignment Length:386 Identity:103/386 - (26%)
Similarity:151/386 - (39%) Gaps:73/386 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GQWRIGPSIGVGGFGEIYAACKV--GEKNYDAVVKCEPH-GNGPLFVEMHFYLRNAKLEDIKQFM 106
            |::::...||.|.||:||.|..:  ||   :..||.|.. ...|..      |..:||..|.|  
Mouse    15 GKYKLVRKIGSGSFGDIYLAINITNGE---EVAVKLESQKARHPQL------LYESKLYKILQ-- 68

  Fly   107 QKHGLKSLGMPYILANGSVEVNGEK-HRFIVMPRYGSDLTKFLEQNGKRLPEGTVYRLAIQMLDV 170
                 ..:|:|:|...|.     || :..:||...|..|........:|....||..||.||:..
Mouse    69 -----GGVGIPHIRWYGQ-----EKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISR 123

  Fly   171 YQYMHSNGYVHADLKAANILLGLEK---------------------------GGAAQAYLVDFGL 208
            .:|:|:..::|.|:|..|.|:|:.:                           .|..|.:|:||||
Mouse   124 IEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSPSQDPSFSGLNQLFLIDFGL 188

  Fly   209 ASHFVTGDFKPDPKKMH---------NGTIEYTSRDAHLGV-PTRRADLEILGYNLIEWLGAELP 263
            |.     .::.:..:.|         .||..|.|.:||||: .:||.|:|.|||.|:.:....||
Mouse   189 AK-----KYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLP 248

  Fly   264 WVTQKLLAVPPKVQKAKEAFMDNIGESLKTLFPKGVPPPIGDFMKYVSKLTHNQEPDYDKCRSWF 328
            |...|......|.:|..|..|....|.|    .||.|.....::.|...|...:.|||...|..|
Mouse   249 WQGLKAATKKQKYEKISEKKMSTPVEVL----CKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLF 309

  Fly   329 SSALKQLKIPNNGDLDFKMKPQTSSNNNLSPPGTSKAATARKAKKIDSPVLNSS--LDEKI 387
            ....:.|....:...|:.|..|.::....|..|..:.|.....|:.|....|..  .|||:
Mouse   310 RILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGIKDEKL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 89/323 (28%)
SPS1 47..432 CDD:223589 102/384 (27%)
Pol_alpha_B_N <399..>502 CDD:285602
Csnk1a1XP_006526446.1 STKc_CK1_alpha 16..309 CDD:271030 88/322 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.