DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and AT5G18190

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001332666.1 Gene:AT5G18190 / 831937 AraportID:AT5G18190 Length:691 Species:Arabidopsis thaliana


Alignment Length:454 Identity:119/454 - (26%)
Similarity:184/454 - (40%) Gaps:119/454 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AKKVVSAKKAKSKLYKMPEKVKEGTVFTDLAKGQWRIGPSIGVGGFGEIYAACKVGEKNYDAVVK 77
            |:|||..:: .|....:||:|:.|.      ...::....:|.||||:::...:|...: |.:  
plant   103 AEKVVGVEE-DSSTAPVPERVQVGN------SPVYKTERKLGKGGFGQVFVGRRVSGGS-DRI-- 157

  Fly    78 CEPHGNGPLFVEMHFYLRNAKLEDIKQFMQKHGLKSLGMP-----YILANGSVEVNGEKHR---- 133
                |...:.|.:.|..||:|           |. :.|.|     |...||...|....|:    
plant   158 ----GADAIEVALKFEHRNSK-----------GC-NFGPPYEWQVYNTLNGCYGVPAVHHKGRQG 206

  Fly   134 ---FIVMPRYGSDLTKFLEQNGKRLPEGTVYRLAIQMLDVYQYMHSNGYVHADLKAANILLGLEK 195
               .:||...|..|......:|:.:....|..:|::.:.:.:.:|..|:||.|:|..|.||| :.
plant   207 DFYILVMDMLGPSLWDVWNSSGQSMSPNMVACIAVESISILEKLHMKGFVHGDVKPENFLLG-QP 270

  Fly   196 GGA--AQAYLVDFGLASHF--------VTGDFKPDPKKMHNGTIEYTSRDAHLG-VPTRRADLEI 249
            |.|  .:.||:|.||||.:        |..|.:||   :..|||.|.|..|||| ..:||.|||.
plant   271 GTADEKKLYLIDLGLASKWKDSHSGQHVEYDQRPD---VFRGTIRYASVHAHLGRTGSRRDDLES 332

  Fly   250 LGYNLIEWLGAELPW-----------VTQKLLAVPPKVQKAKEAFMDNIGESLKTLFPKGVPPPI 303
            |.|.||..|...|||           |.:|.::..|:               |...|   .|||.
plant   333 LAYTLIFLLKGRLPWQGYQGDNKSFLVCKKKMSTSPE---------------LMCCF---CPPPF 379

  Fly   304 GDFMKYVSKLTHNQEPDYDKCRSWFSSALKQLKIPNNGDLDFKMKPQTSSNNNLSPPGTSKAATA 368
            ..|::.|:.:..::||:|.|..|.|.|.::|..                    ||.|        
plant   380 KLFLEAVTNMKFDEEPNYAKLISIFDSLIEQCA--------------------LSRP-------- 416

  Fly   369 RKAKKIDSPVLNSSLDEKISASEDDEEEEEKSHRKKTAKKVTPSARNAKVSPLKR-----VADS 427
               .|||..:.......::..:.|::|:.:|..|..:......|..||: .|:|:     ||||
plant   417 ---IKIDGALKVGQKRGRMLLNLDEDEQPKKKIRIGSPACQWISVYNAR-RPMKQRYHYNVADS 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 89/325 (27%)
SPS1 47..432 CDD:223589 110/420 (26%)
Pol_alpha_B_N <399..>502 CDD:285602 11/34 (32%)
AT5G18190NP_001332666.1 STKc_CK1 130..404 CDD:270918 88/314 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.