DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and ckl3

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001329054.1 Gene:ckl3 / 829009 AraportID:AT4G28880 Length:415 Species:Arabidopsis thaliana


Alignment Length:443 Identity:128/443 - (28%)
Similarity:184/443 - (41%) Gaps:76/443 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GQWRIGPSIGVGGFGEIYAACKVGEKNYDAV-VKCEPHGNGPLFVEMHFYLRNAK------LEDI 102
            |::::|..||.|.||||:.|..|  ..::.| ||.|                |:|      |.:.
plant     7 GKYKLGRKIGGGSFGEIFLATHV--DTFEIVAVKIE----------------NSKTKHPQLLYEA 53

  Fly   103 KQFMQKHGLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGKRLPEGTVYRLAIQM 167
            |.:....|  ..|:|.|...|   |:|.::. :||...|..|.......|::....||..||.||
plant    54 KLYRILEG--GSGIPRIKWFG---VDGTENA-LVMDLLGPSLEDLFVYCGRKFSPKTVLMLADQM 112

  Fly   168 LDVYQYMHSNGYVHADLKAANILLGLEKGGAAQAYLVDFGLASHFVTGDFKPD----PKKMHNGT 228
            |...:::||.||:|.|:|..|.|:||.: .|.|.||:|||||..:...:....    ..|...||
plant   113 LTRIEFVHSKGYLHRDIKPDNFLMGLGR-KANQVYLIDFGLAKRYRDANTNRHIPYRENKNLTGT 176

  Fly   229 IEYTSRDAHLGV-PTRRADLEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMDNIGESLK 292
            ..|.|.:.|||: .:||.|||.|||.|:.:|...|||  |.|.||..| ||..:.....|...::
plant   177 ARYASCNTHLGIEQSRRDDLESLGYVLLYFLRGSLPW--QGLKAVDKK-QKYDKICEKKISTPIE 238

  Fly   293 TLFPKGVPPPIGDFMKYVSKLTHNQEPDYDKCRSWFSSALKQLKIPNNGDLDF--------KMKP 349
            .|. |..|.....:..|...||.:|.|||...:..|    :.|......:.|:        ..:.
plant   239 VLC-KNHPVEFASYFHYCHTLTFDQRPDYGFLKRLF----RDLFSREGYEFDYIFDWTIIKYQQA 298

  Fly   350 QTSSNNNLSPPGTSKAATARKAKKIDSPVLNSSLDEKISASEDDEEEEEKSHRKKTAKKVTPSAR 414
            |.|.|.:.:.||:|..    :|..:|:.  |......||      .|.|.|.|.::|..:.||.:
plant   299 QKSRNQSQAVPGSSNP----RAMPVDTS--NHRGGPNIS------YEAEASERVRSANAIGPSPQ 351

  Fly   415 NAKVSPLKRVADSSPPSQKRVKTEPKSTPRERATPKASPKPRSTPKASPKPQT 467
            ....:...|......|..|.:.           .|..|..|..|.|.:..|:|
plant   352 INNNTAAGRTPGFDHPVHKNMN-----------MPSTSLSPAGTSKRNVGPET 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 97/294 (33%)
SPS1 47..432 CDD:223589 119/404 (29%)
Pol_alpha_B_N <399..>502 CDD:285602 15/69 (22%)
ckl3NP_001329054.1 PKc_like 8..282 CDD:419665 98/306 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.