DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and CKL6

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_567812.1 Gene:CKL6 / 828972 AraportID:AT4G28540 Length:479 Species:Arabidopsis thaliana


Alignment Length:453 Identity:123/453 - (27%)
Similarity:185/453 - (40%) Gaps:96/453 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GQWRIGPSIGVGGFGEIYAA--CKVGEKNYDAVVKCEP----HGNGPLFVEMHFYLRNAKLEDIK 103
            |::::|..||.|.|||::.|  .:.||   :|.||.||    |      .::|:        :.|
plant    11 GKFKLGRKIGGGSFGELFLAVSLQTGE---EAAVKLEPAKTKH------PQLHY--------ESK 58

  Fly   104 QFMQKHGLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGKRLPEGTVYRLAIQML 168
            .:|...|  ..|:|.:...|   |.|: :..:|:...|..|........:||....|..||.|::
plant    59 IYMLLQG--GSGIPSLKWFG---VQGD-YNAMVIDLLGPSLEDLFNYCNRRLTLKAVLMLADQLI 117

  Fly   169 DVYQYMHSNGYVHADLKAANILLGLEKGGAAQAYLVDFGLASHFVTGDFKPD------PKKMHNG 227
            ...:||||.|::|.|:|..|.|:||.: .|.|.|::|||||..:  .|.:..      ..|...|
plant   118 SRVEYMHSRGFLHRDIKPDNFLMGLGR-KANQVYIIDFGLAKKY--RDLQTHRHIPYRENKNLTG 179

  Fly   228 TIEYTSRDAHLGV-PTRRADLEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMDNIGESL 291
            |..|.|.:.|||| .:||.|||.|||.|:.:|...|||   :.|....|.||     .|.|.|. 
plant   180 TARYASVNTHLGVEQSRRDDLESLGYVLMYFLRGSLPW---QGLKAGTKKQK-----YDRISEK- 235

  Fly   292 KTLFP-----KGVPPPIGDFMKYVSKLTHNQEPDYDKCRSWFSSALKQLKIPNNGDLDFKM---- 347
            |...|     |..||....:.:|...|....:|||    |:.....:.|.|......|:..    
plant   236 KVSTPIEVLCKSYPPEFVSYFQYCRSLRFEDKPDY----SYLKRLFRDLFIREGYQFDYVFDWTA 296

  Fly   348 --KPQTSSNNNLS--------PPGTSKAATARKAKKIDSPVLNSSLDEKISASED---------- 392
              .||:|:.::.|        .||.....:|.|.::|..    .::.:|.|.:.:          
plant   297 LKHPQSSARSHSSTHERHRTGKPGMGAGPSAEKPERISV----GNIRDKFSGAVEAFARRNVRGP 357

  Fly   393 DEEEEEKSHR--------KKTAKKVTPSARNAK---VSPLKRVADSSPPSQKRVKTEPKSTPR 444
            ...:....||        |.....|:...||..   .:..:.||..|.||....:.|.:.:.|
plant   358 SPHQNHTRHRTLDEIPSMKPAVNMVSEKGRNTSRYGSASRRAVASGSRPSSSGEQRESRDSSR 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 96/300 (32%)
SPS1 47..432 CDD:223589 119/437 (27%)
Pol_alpha_B_N <399..>502 CDD:285602 13/57 (23%)
CKL6NP_567812.1 STKc_CK1_delta_epsilon 12..286 CDD:271027 97/312 (31%)
PHA03307 302..>471 CDD:223039 22/123 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.