DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and AT4G08800

DIOPT Version :10

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_192620.1 Gene:AT4G08800 / 826451 AraportID:AT4G08800 Length:285 Species:Arabidopsis thaliana


Alignment Length:316 Identity:85/316 - (26%)
Similarity:128/316 - (40%) Gaps:85/316 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 QWRIGPSIGVGGFGEIYAACKVGEKNYDAVVKCEPHGNGPLFVEMHFYLRNAKLEDIKQFMQKHG 110
            ::|:|..||.|.|||||....| :.|.|..:                     |.|.:|       
plant     8 KFRLGRKIGSGAFGEIYLGTDV-QSNEDVAI---------------------KFESVK------- 43

  Fly   111 LKSLGMPYILANGSVEVNGEKHRFIVMPR--YGSDLTKFLEQNGKRLPE---------GTVYRLA 164
                                    .|.|:  |.|.:.:.| |:|..:|.         .||..||
plant    44 ------------------------TVHPQLAYESRIYRVL-QSGNGIPNMKWYGKFSLKTVLMLA 83

  Fly   165 IQMLDVYQYMHSNGYVHADLKAANILLGLEKGGAAQAYLVDFGLASHF-VTGDFKPDP---KKMH 225
            .||::..:::||..::|.|:|..|.|:|  |.|.:     |||||..: .:..::..|   .|..
plant    84 DQMINRLEFIHSKSFLHRDIKPDNFLMG--KAGKS-----DFGLARKYRDSSSYRHIPYRENKSL 141

  Fly   226 NGTIEYTSRDAHLGV-PTRRADLEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMDNIGE 289
            .||..|.|.:.|||: .:||.|:|.|||.|:.:|...|||   |.|....|.||..:.....:..
plant   142 TGTPAYASLNTHLGIEQSRRDDVESLGYILMYFLKGSLPW---KGLKAGNKKQKYDKISEKKVST 203

  Fly   290 SLKTLFPKGVPPPIGDFMKYVSKLTHNQEPDYDKCRSWFSSALKQLKIPNNGDLDF 345
            |::||. :|.|.....::.|...|..:.:|||    ::.....:.|.|......||
plant   204 SIETLC-EGHPIEFATYIHYCRSLRFDDKPDY----AYLKRLFRDLFIREGFQFDF 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 81/297 (27%)
PRK11633 <410..>471 CDD:236940
AT4G08800NP_192620.1 Protein Kinases, catalytic domain 8..250 CDD:473864 83/310 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.