DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and ckl10

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_188976.1 Gene:ckl10 / 821915 AraportID:AT3G23340 Length:442 Species:Arabidopsis thaliana


Alignment Length:478 Identity:125/478 - (26%)
Similarity:190/478 - (39%) Gaps:111/478 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GQWRIGPSIGVGGFGEIYAACKV--GEKNYDAVVKCEP----HGNGPLFVEMHFYLRNAKLEDIK 103
            |::::|..||.|.|||:|....|  ||   :..:|.||    |      .::|:        :.|
plant     7 GKFKLGRKIGSGSFGELYIGINVQTGE---EVALKLEPVKTKH------PQLHY--------ESK 54

  Fly   104 QFMQKHGLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGKRLPEGTVYRLAIQML 168
            .:|...|  ..|:|:|...| ||.|   :..:.:...|..|........:.....||..||.|::
plant    55 VYMLLQG--GTGVPHIKWFG-VEGN---YNCMAIDLLGPSLEDLFNYCTRSFSLKTVLMLADQLI 113

  Fly   169 DVYQYMHSNGYVHADLKAANILLGLEKGGAAQAYLVDFGLASHF---VTGDFKP-DPKKMHNGTI 229
            :..:||||.|::|.|:|..|.|:||.: .|.|.|::|:|||..:   .|....| ...|...||.
plant   114 NRVEYMHSRGFLHRDIKPDNFLMGLGR-KANQVYIIDYGLAKKYRDLQTHKHIPYRENKNLTGTA 177

  Fly   230 EYTSRDAHLGV-PTRRADLEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMDNIGESLKT 293
            .|.|.:.|||: .:||.|||.|||.|:.::...|||...|......|.:|..|.         |.
plant   178 RYASVNTHLGIEQSRRDDLESLGYVLMYFIRGSLPWQGLKAGTKKQKYEKISEK---------KM 233

  Fly   294 LFP-----KGVPPPIGDFMKYVSKLTHNQEPDYDKCRSWFSSALKQ-------------LKIPNN 340
            |.|     |..|.....:..|...|....:|||...:..|.....:             ||.|.:
plant   234 LTPVEVLCKSYPSEFTSYFHYCRSLRFEDKPDYSYLKRLFRDLFIREGYQFDYVFDWTILKYPQS 298

  Fly   341 GDLDFKMKPQTSSNNNLSPPGTSKAATARKAKKIDSPVLNSSLDEKISAS--------------- 390
            |.:.   ||:.:....|.|||.|       |::.:.|::...|.|:.|.:               
plant   299 GSIS---KPRPNPKPALDPPGPS-------AERNEKPIVGQDLRERFSGAVEAFARRNVPSHGIR 353

  Fly   391 -----EDDEEEEEKSHRKKTAKKVTPSARNAKVSPLKRVADSSPPSQKRVKTEPKSTPRERATPK 450
                 .||..:|         .:|:...|| :::....|..||.|......:|.:|:....:   
plant   354 PKHIFSDDASKE---------VQVSEKTRN-EIATKMAVMSSSQPGSSGELSENRSSKLFSS--- 405

  Fly   451 ASPKPRSTPKASPKPQTPTAARL 473
                  |..|..|..:|..:|||
plant   406 ------SAQKIQPVQETKLSARL 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 89/298 (30%)
SPS1 47..432 CDD:223589 115/433 (27%)
Pol_alpha_B_N <399..>502 CDD:285602 16/75 (21%)
ckl10NP_188976.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 89/306 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.