DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and AT3G03930

DIOPT Version :10

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_187043.1 Gene:AT3G03930 / 820302 AraportID:AT3G03930 Length:287 Species:Arabidopsis thaliana


Alignment Length:74 Identity:18/74 - (24%)
Similarity:25/74 - (33%) Gaps:13/74 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PAKKVVSAKKAKSKLYKMPEKVKEGTVFTDLAKGQ---WRIGPSIGVGGFGEIYA---------- 63
            |.|:......|.|:|....||.|...:|......:   |.:....|.|...::|.          
plant    61 PMKQRFHHNIANSRLSHHAEKGKRDGLFISCVASEANLWALVMDAGTGFTSQVYKFSSTFLPKDW 125

  Fly    64 ACKVGEKNY 72
            ..|..||||
plant   126 IMKQWEKNY 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 10/50 (20%)
PRK11633 <410..>471 CDD:236940
AT3G03930NP_187043.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.