DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and AT3G03940

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_187044.1 Gene:AT3G03940 / 819551 AraportID:AT3G03940 Length:701 Species:Arabidopsis thaliana


Alignment Length:374 Identity:100/374 - (26%)
Similarity:158/374 - (42%) Gaps:90/374 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AKKVVSAKKAKSKLYKMPEKVKEGTVFTDLAKGQWRIGPSIGVGGFGEIY-------AACKVGEK 70
            |:|||..:: .|.:..:||:|:.|.      ...::....:|.||||::|       .:.::|..
plant   113 AEKVVGMEE-DSSMGPVPERVQVGN------SPVYKTERKLGKGGFGQVYVGRRVSGGSDRIGAD 170

  Fly    71 NYDAVVKCEPHGN------GPLFVEMHFYLRNAKLEDIKQFMQKHGLKS-LGMPYILANGSVEVN 128
            ..:..:|.| |.|      ||.: |...|               :.|.| .|:|      :|...
plant   171 AIEVALKLE-HRNSKGCNFGPPY-EWQVY---------------NTLNSCYGIP------AVHHK 212

  Fly   129 GEKHRF--IVMPRYGSDLTKFLEQNGKRLPEGTVYRLAIQMLDVYQYMHSNGYVHADLKAANILL 191
            |.:..|  :||...|..|........:.:....|..:|::.:.:.:.:|..|:||.|:|..|.||
plant   213 GRQGDFYILVMDMLGPSLWDVWNSLAQSMSPNMVACIAVEAISILEKLHMKGFVHGDVKPENFLL 277

  Fly   192 GLEKGGA--AQAYLVDFGLASHF--------VTGDFKPDPKKMHNGTIEYTSRDAHLG-VPTRRA 245
            | :.|.|  .:.||:|.||||.:        |..|.:||   :..|||.|.|..|||| ..:||.
plant   278 G-QPGTADEKKLYLIDLGLASRWKDSHSGQHVEYDQRPD---VFRGTIRYASCHAHLGRTGSRRD 338

  Fly   246 DLEILGYNLIEWLGAELPW-----------VTQKLLAVPPKVQKAKEAFMDNIGESLKTLFPKGV 299
            |||.|.|.||..:...|||           |.:|.::..|:               |...|   .
plant   339 DLESLAYTLIFLMRGRLPWQGYQGDNKSFLVCKKKMSTSPE---------------LMCCF---C 385

  Fly   300 PPPIGDFMKYVSKLTHNQEPDYDKCRSWFSSALKQLKIPNNGDLDFKMK 348
            |||...|::.|:.:..::||:|.|..|.|.:.::...|.....:|..:|
plant   386 PPPFKLFLEAVTNMKFDEEPNYAKLISIFDTLIEPCAISRPIRIDGALK 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 88/329 (27%)
SPS1 47..432 CDD:223589 91/340 (27%)
Pol_alpha_B_N <399..>502 CDD:285602
AT3G03940NP_187044.1 STKc_CK1 140..414 CDD:270918 87/318 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.