DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and AT2G25760

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_973532.1 Gene:AT2G25760 / 817118 AraportID:AT2G25760 Length:676 Species:Arabidopsis thaliana


Alignment Length:422 Identity:114/422 - (27%)
Similarity:163/422 - (38%) Gaps:118/422 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 MPEKVKEGTVFTDLAKGQWRIGPSIGVGGFGEIYAACKVGEKNYDAVVKCEPHGNGPLFVEMHFY 93
            :||||:.|.      ...:::...:|.||||::|...|:|....:|     ..|.|.|.|.:.|.
plant    95 LPEKVQVGN------SPMYKLDRKLGKGGFGQVYVGRKMGTSTSNA-----RFGPGALEVALKFE 148

  Fly    94 LRNAKLEDIKQFMQKHGLKSLGMP-----YILANGS-----VEVNGEKHRF--IVMPRYGSDLTK 146
            .|.:|           |. :.|.|     |....||     |...|.:..|  :||...|..|..
plant   149 HRTSK-----------GC-NYGPPYEWQVYNALGGSHGVPRVHFKGRQGDFYVMVMDILGPSLWD 201

  Fly   147 FLEQNGKRLPEGTVYRLAIQMLDVYQYMHSNGYVHADLKAANILLG-----LEKGGAAQAYLVDF 206
            ......:.:....|..:||:.:.:.:.|||.||||.|:|..|.|||     .||    :.:|||.
plant   202 VWNSTTQAMSTEMVACIAIEAISILEKMHSRGYVHGDVKPENFLLGPPGTPEEK----KLFLVDL 262

  Fly   207 GLASHF---VTG-----DFKPDPKKMHNGTIEYTSRDAHLG-VPTRRADLEILGYNLIEWLGAEL 262
            ||||.:   .||     |.:||   :..||:.|.|..|||| ..:||.|||.|.|.|:..|...|
plant   263 GLASKWRDTATGLHVEYDQRPD---VFRGTVRYASVHAHLGRTCSRRDDLESLAYTLVFLLRGRL 324

  Fly   263 PW--------------VTQKLLAVPPKVQKAKEAFMDNIGESLKTLFPKGVPPPIGDFMKYVSKL 313
            ||              |.:|.:|..|              |:|....|:    |...|::||..|
plant   325 PWQGYQVGDTKNKGFLVCKKKMATSP--------------ETLCCFCPQ----PFRQFVEYVVNL 371

  Fly   314 THNQEPDYDKCRSWFSSALKQLKIPNNGDLDFKMKPQTSSNNNLSPPGTSKAATARKAKKIDSPV 378
            ..::||||.|..|.|...:                   ..|.::.|..|..|..           
plant   372 KFDEEPDYAKYVSLFDGIV-------------------GPNPDIRPINTEGAQK----------- 406

  Fly   379 LNSSLDEKISASEDDEEEEEKSHRKKTAKKVT 410
            |...:.:|......|||:|:.:.:.:.....|
plant   407 LIHQVGQKRGRLTMDEEDEQPTKKIRLGMPAT 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 98/331 (30%)
SPS1 47..432 CDD:223589 109/404 (27%)
Pol_alpha_B_N <399..>502 CDD:285602 1/12 (8%)
AT2G25760NP_973532.1 STKc_CK1 106..386 CDD:270918 97/321 (30%)
Pkinase 107..366 CDD:278497 88/300 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.