DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and vrk3

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001037922.1 Gene:vrk3 / 733538 XenbaseID:XB-GENE-986614 Length:511 Species:Xenopus tropicalis


Alignment Length:353 Identity:99/353 - (28%)
Similarity:171/353 - (48%) Gaps:45/353 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AAAPAK----------KVVSAKKAKSKLYKMPEKVKEGTVFTDLAKGQWRIGPSIGVGGFGEIYA 63
            |::||.          ||...|..|.:|      :.|..:.||....:||:...:.....|.:|.
 Frog   172 ASSPASLHGSKSKNSPKVRGVKSVKIEL------LPENEILTDTQSVKWRLAEFLSAWNTGMLYK 230

  Fly    64 ACKVG----EKNYDAVVKCEPHGNGPLFVEMHFYLRNAKLEDIKQFMQKHGLKSLGMPYILANGS 124
            |.|..    |::|.|.:..:   :|.:|.|.:|:.|.||...:.::.:.|....:|:|..:..|.
 Frog   231 AYKTSSAAEEQHYIAKLDAK---DGRIFTEQNFFQRAAKKNIVDKWKKSHSCPLIGIPDCVGFGV 292

  Fly   125 VEVNGEKHRFIVMPRYGSDLTKFL--EQNGKRLPEGTVYRLAIQMLDVYQYMHSNGYVHADLKAA 187
                .|.:||::....|.:|...:  :.:|| |||..::.::.::::..:|:|.|.|||.|:.|.
 Frog   293 ----HESYRFLIFSALGQNLQSVIDDDDDGK-LPEKAIFHISYRIINTLEYIHENEYVHGDITAE 352

  Fly   188 NILLGLEKGGAAQAYLVDFGLASHF------VTGDFKPDPKKMHNGTIEYTSRDAHLG-VPTRRA 245
            ||.  :.:...::.||..:..|..:      ||  ::...:..|.||.|:.|.|.|.| .|:||:
 Frog   353 NIF--VNRNDPSEVYLAGYYFAFRYCPCGKHVT--YREGGRSPHEGTAEFISEDIHKGAAPSRRS 413

  Fly   246 DLEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMDNIGESLKTLF-PKGVPPPIGDFMKY 309
            |||.|||.:::||...|||..|   ..|..:.:.|:.|..||.|.|...| .:..|..:..:::|
 Frog   414 DLESLGYCMLKWLCGSLPWSEQ---TNPNTIMEQKKRFKTNIAEFLGQSFKQRKFPDGLRKYLEY 475

  Fly   310 VSKLTHNQEPDYDKCRSWFSSALKQLKI 337
            |..|::.::|||...|:..|.||.::.|
 Frog   476 VMNLSYEEKPDYTVLRNTLSCALAKMGI 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 86/305 (28%)
SPS1 47..432 CDD:223589 88/305 (29%)
Pol_alpha_B_N <399..>502 CDD:285602
vrk3NP_001037922.1 zinc_ribbon_2 5..27 CDD:379084
PKc_like 203..498 CDD:389743 87/309 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 155 1.000 Domainoid score I4175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D371612at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.