DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and Csnk1g3

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_006526293.1 Gene:Csnk1g3 / 70425 MGIID:1917675 Length:456 Species:Mus musculus


Alignment Length:343 Identity:92/343 - (26%)
Similarity:144/343 - (41%) Gaps:73/343 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 WRIGPSIGVGGFGEIYAACKVGEKNYD---AVVKCEP-HGNGP-LFVEMHFYLRNAKLEDIKQFM 106
            :|:|..||.|.|||:    ::|:..|.   ..:|.|| ....| |.:|..||             
Mouse    43 FRVGKKIGCGNFGEL----RLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFY------------- 90

  Fly   107 QKHGLKSL----GMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGKRLPEGTVYRLAIQM 167
                 |.|    |:|.:...|..    .|:..:|:...|..|....:...:.....||..:|||:
Mouse    91 -----KQLGSGDGIPQVYYFGPC----GKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQL 146

  Fly   168 LDVYQYMHSNGYVHADLKAANILLGLEKGGAAQ--AYLVDFGLASHFVTGDFKPD-PKKMH---N 226
            :...:|:||...::.|:|..|.|:| ..|..||  .:::|||||..::..:.|.. |.:.|   .
Mouse   147 ISRMEYVHSKNLIYRDVKPENFLIG-RPGNKAQQVIHIIDFGLAKEYIDPETKKHIPYREHKSLT 210

  Fly   227 GTIEYTSRDAHLG-VPTRRADLEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMDNIGES 290
            ||..|.|.:.||| ..:||.|||.||:..:.:|...|||...|...:..:.||        ||::
Mouse   211 GTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQK--------IGDT 267

  Fly   291 LKT----LFPKGVPPPIGDFMKYVSKLTHNQEPDYDKCRSWFSSAL---------------KQLK 336
            .:.    :..:..|..:..:::||.:|...::||||..|..|:...               |||.
Mouse   268 KRATPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLP 332

  Fly   337 IPNNGDLDFKMKPQTSSN 354
            .|...   .:..|..|||
Mouse   333 TPVGA---VQQDPALSSN 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 83/300 (28%)
SPS1 47..432 CDD:223589 92/343 (27%)
Pol_alpha_B_N <399..>502 CDD:285602
Csnk1g3XP_006526293.1 STKc_CK1_gamma 42..329 CDD:271028 84/320 (26%)
CK1gamma_C 329..418 CDD:403712 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.