DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and Csnk1g2

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_006241063.1 Gene:Csnk1g2 / 65278 RGDID:621407 Length:441 Species:Rattus norvegicus


Alignment Length:408 Identity:103/408 - (25%)
Similarity:178/408 - (43%) Gaps:60/408 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 WRIGPSIGVGGFGEIYAACKVGEKNYD---AVVKCEP-HGNGP-LFVEMHFYLR-NAKLEDIKQ- 104
            :|:|..||.|.|||:    ::|:..|.   ..:|.|| ....| |.:|..||.: :...||..: 
  Rat    46 FRVGKKIGCGNFGEL----RLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLSTTGEDTGRG 106

  Fly   105 --FMQKHGLKSLGMPYILANGSVEVN--GE--KHRFIVMPRYGSDLTKFLEQNGKRLPEGTVYRL 163
              .:...||::..:...||.|..:|.  |.  |:..:|:...|..|....:...:.....||..:
  Rat   107 AALLGGQGLRTPSIDVSLAEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMI 171

  Fly   164 AIQMLDVYQYMHSNGYVHADLKAANILLGLEKGGAAQ--AYLVDFGLASHFVTGDFKPD-PKKMH 225
            |||::...:|:|:...::.|:|..|.|:| ..|...|  .:::|||||..::..:.|.. |.:.|
  Rat   172 AIQLITRMEYVHTKSLIYRDVKPENFLVG-RPGSKRQHSIHIIDFGLAKEYIDPETKKHIPYREH 235

  Fly   226 ---NGTIEYTSRDAHLG-VPTRRADLEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMDN 286
               .||..|.|.:.||| ..:||.|||.||:..:.:|...|||...|...:..:.||        
  Rat   236 KSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQK-------- 292

  Fly   287 IGESLKT----LFPKGVPPPIGDFMKYVSKLTHNQEPDYDKCRSWFSSALKQLKIPNNGDLDFKM 347
            ||::.:.    :..:..|..:..:::||.:|...::||||..|..|:....:.....:.:.|:..
  Rat   293 IGDTKRATPIEVLCESFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRSGYVFDYEYDWAG 357

  Fly   348 KPQTSSNNNL------SPPGTSKAATARKAKKI---------DSPVLNSSLDEKISASEDDEEEE 397
            ||..:....:      .||...||....|.:.:         |.|....| :..|:|..:.|..:
  Rat   358 KPLPTPIGTVHPDVPSQPPHRDKAQLHTKNQALNSTNGELNTDDPTAGHS-NAPIAAPAEVEVAD 421

  Fly   398 E-------KSHRKKTAKK 408
            |       |..::|:.::
  Rat   422 ETKCCCFFKRRKRKSLQR 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 85/304 (28%)
SPS1 47..432 CDD:223589 103/408 (25%)
Pol_alpha_B_N <399..>502 CDD:285602 2/10 (20%)
Csnk1g2XP_006241063.1 STKc_CK1_gamma 45..358 CDD:271028 87/324 (27%)
SPS1 45..>355 CDD:223589 86/321 (27%)
CK1gamma_C 358..400 CDD:289378 7/41 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.