DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and csnk1g2a

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_005171263.1 Gene:csnk1g2a / 554152 ZFINID:ZDB-GENE-030131-6445 Length:452 Species:Danio rerio


Alignment Length:378 Identity:99/378 - (26%)
Similarity:154/378 - (40%) Gaps:84/378 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 WRIGPSIGVGGFGEIYAACKVGEKNYD---AVVKCEP-HGNGP-LFVEMHFY--LRNAKLEDIKQ 104
            :|:|..||.|.|||:    ::|:..|.   ..:|.|| ....| |.:|..||  |.||:      
Zfish    50 FRVGKKIGCGNFGEL----RLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGNAE------ 104

  Fly   105 FMQKHGLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGKRLPEGTVYRLAIQMLD 169
                      |:|.:...|..    .|:..:|:...|..|....:...:.....||..:|||::.
Zfish   105 ----------GVPQVYYFGPC----GKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLIT 155

  Fly   170 VYQYMHSNGYVHADLKAANILLGLEKGGAAQ--AYLVDFGLASHFVTGDFKPD-PKKMH---NGT 228
            ..:::|:...::.|:|..|.|:| ..|...|  .:::|||||..::..:.|.. |.:.|   .||
Zfish   156 RMEFVHTRSLIYRDVKPENFLVG-RPGTKRQHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGT 219

  Fly   229 IEYTSRDAHLG-VPTRRADLEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMDNIGESLK 292
            ..|.|.:.||| ..:||.|||.||:..:.:|...|||...|...:..:.||..:.......|.|.
Zfish   220 ARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLC 284

  Fly   293 TLFPKGVPPPIGDFMKYVSKLTHNQEPDYDKCRSWFSSAL---------------KQLKI----- 337
            ..||:     :..:::||.:|...:.|||:..|..|:...               |.|..     
Zfish   285 ESFPE-----MATYLRYVRRLDFFERPDYEYLRKLFTDLFDRNGYVFDYEYDWVGKPLPTPIGPM 344

  Fly   338 -------PNNGDLDFKMKPQTSSNNNLSPPGTSKAATARKAKKIDSPVLNSSL 383
                   |:|.|   |.:||| .|.:..|.|:....|         ||.|..|
Zfish   345 PSDTPLQPSNRD---KAQPQT-KNQSPEPKGSESQPT---------PVTNREL 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 81/294 (28%)
SPS1 47..432 CDD:223589 99/378 (26%)
Pol_alpha_B_N <399..>502 CDD:285602
csnk1g2aXP_005171263.1 SPS1 49..415 CDD:223589 99/378 (26%)
STKc_CK1_gamma 49..335 CDD:271028 82/314 (26%)
CK1gamma_C 335..411 CDD:289378 17/63 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.