DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and vrk3

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001013586.1 Gene:vrk3 / 541443 ZFINID:ZDB-GENE-030131-246 Length:459 Species:Danio rerio


Alignment Length:356 Identity:94/356 - (26%)
Similarity:160/356 - (44%) Gaps:42/356 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRVAKPKAAAPAKKVVSAKKAKS-KLYKMPEKVKEGTVFTDLAKGQWRIGPSIGVGGFGEIYAAC 65
            |.:...:|...:..:.|..|.|| |.....:.|.||||..|.:..:|::...:........|..|
Zfish   119 PLIKDEEAKKTSPAIQSPSKCKSKKRVSSVDPVLEGTVVCDQSGKKWKLIELLWKTELDVTYGVC 183

  Fly    66 ---------------KVGEKNYDAVVKCEPHGNGPLFVEMHFYLRNAKLEDIKQFMQKHGLKSLG 115
                           ::|.|            .|.||.|.:|:||.||.:.::::.:.|.|..||
Zfish   184 QANQHAESDECKYMLRLGAK------------EGHLFNEQNFHLRAAKPDAVEKWGKLHKLDFLG 236

  Fly   116 MPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGKRLPEGTVYRLAIQMLDVYQYMHSNGYV 180
            :|..:..|.    .|.:||:|.|..|..|...|::....|.|..|.:||:::||..:::|...|.
Zfish   237 IPSCVGFGL----HETYRFLVFPCMGQPLQTELDEGTGSLSEKNVLQLALRLLDSLEFIHEKEYA 297

  Fly   181 HADLKAANILLGLEKGGAAQAYLVDFGLASHFVTG----DFKPDPKKMHNGTIEYTSRDAHLGV- 240
            |||:.|.||.  ::.....:.:|..||.|..|..|    :::...:..|.|.|.:.|.|:|.|. 
Zfish   298 HADIHAGNIY--IKSSSHTEVFLSGFGHAFRFCPGGKHVEYRQGSRTAHQGNISFISLDSHKGAG 360

  Fly   241 PTRRADLEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMDNIGESLKTLF-PKGVPPPIG 304
            |:||:||:.|||.::.|:...|||  ..|......|...||.:|.::...|...: .|.....:.
Zfish   361 PSRRSDLQSLGYCMLCWMTGSLPW--SHLSHNSSSVAAEKERYMSDVPGLLTYCYKQKKASSALQ 423

  Fly   305 DFMKYVSKLTHNQEPDYDKCRSWFSSALKQL 335
            :::..|..|.:.::|||...:.....:|:::
Zfish   424 EYLCNVMALQYTEKPDYTLLKGGLQQSLQKM 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 84/312 (27%)
SPS1 47..432 CDD:223589 81/310 (26%)
Pol_alpha_B_N <399..>502 CDD:285602
vrk3NP_001013586.1 DUF4758 <9..>104 CDD:292572
PK_VRK3 154..451 CDD:271026 84/316 (27%)
SPS1 236..>384 CDD:223589 49/153 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583606
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D371612at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.