DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and CSNK1G1

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001316534.1 Gene:CSNK1G1 / 53944 HGNCID:2454 Length:475 Species:Homo sapiens


Alignment Length:399 Identity:102/399 - (25%)
Similarity:171/399 - (42%) Gaps:68/399 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 WRIGPSIGVGGFGEIYAACKVGEKNYD---AVVKCEP-HGNGP-LFVEMHFYLRNAKLEDIKQFM 106
            :|:|..||.|.|||:    ::|:..|.   ..:|.|| ....| |.:|..||         ||. 
Human    44 FRVGKKIGCGNFGEL----RLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFY---------KQL- 94

  Fly   107 QKHGLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGKRLPEGTVYRLAIQMLDVY 171
               |....|:|.:...|..    .|:..:|:...|..|....:...:.....||..:|||:|...
Human    95 ---GSAGEGLPQVYYFGPC----GKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRM 152

  Fly   172 QYMHSNGYVHADLKAANILLGLEKGGAAQ--AYLVDFGLASHFVTGDFKPD-PKKMH---NGTIE 230
            :|:||...::.|:|..|.|:| .:|...:  .:::|||||..::..:.|.. |.:.|   .||..
Human   153 EYVHSKNLIYRDVKPENFLIG-RQGNKKEHVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTAR 216

  Fly   231 YTSRDAHLG-VPTRRADLEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMDNIGESLKTL 294
            |.|.:.||| ..:||.|||.||:..:.:|...|||...|...:..:.||..:...:...|:|...
Human   217 YMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCEN 281

  Fly   295 FPKGVPPPIGDFMKYVSKLTHNQEPDYDKCRSWFSSALKQLKIPNNGDLDFKMKPQTSSNNNLSP 359
            ||:    .:..:::||.:|...::|||:..|:.|:...::.....:...|:..:|          
Human   282 FPE----EMATYLRYVRRLDFFEKPDYEYLRTLFTDLFEKKGYTFDYAYDWVGRP---------- 332

  Fly   360 PGTSKAATARKAKKIDSPVLNSSLDEKISASEDDEEEEEKSHRKKTAKKVTPSARNAKVSPLKRV 424
                          |.:||.:..:|...||.    ..|..:||.:.:::  ...||..||..:|.
Human   333 --------------IPTPVGSVHVDSGASAI----TRESHTHRDRPSQQ--QPLRNQNVSSERRG 377

  Fly   425 ADSSPPSQK 433
            .....||::
Human   378 EWEIQPSRQ 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 83/292 (28%)
SPS1 47..432 CDD:223589 101/396 (26%)
Pol_alpha_B_N <399..>502 CDD:285602 9/35 (26%)
CSNK1G1NP_001316534.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149467
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.