DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and VRK3

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_057524.3 Gene:VRK3 / 51231 HGNCID:18996 Length:474 Species:Homo sapiens


Alignment Length:378 Identity:105/378 - (27%)
Similarity:176/378 - (46%) Gaps:49/378 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRVAKPKAAAPAKKVVSAKKA--------KSKLYKMPEKVKEGTVFTDLAKGQWRIGPSIGVGGF 58
            |:|.:   .:|.|...|.:|.        :|::....|.:..|||.||.:..||::.........
Human   116 PQVTR---GSPQKTSCSPQKTRQSPQTLKRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQ 177

  Fly    59 GEIYAA-------CKVGEKNYDAVVKCEPHGNGPLFVEMHFYLRNAKLEDIKQFMQKHGLKSLGM 116
            |.:|.|       |..|.:.....:|.:.. :|.||.|.:|:.|.||...:.::.:.:....|.:
Human   178 GILYEAAPTSTLTCDSGPQKQKFSLKLDAK-DGRLFNEQNFFQRAAKPLQVNKWKKLYSTPLLAI 241

  Fly   117 PYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGKR-LPEGTVYRLAIQMLDVYQYMHSNGYV 180
            |..:..|   |:.:|:||:|:|..|..|...|:.:.|. |.|.:|.::|.::||..:::|.|.||
Human   242 PTCMGFG---VHQDKYRFLVLPSLGRSLQSALDVSPKHVLSERSVLQVACRLLDALEFLHENEYV 303

  Fly   181 HADLKAANILLGLEKGGAAQAYLVDFGLA-------SH--FVTGDFKPDPKKMHNGTIEYTSRDA 236
            |.::.|.||.:..|  ..:|..|..:|.|       .|  :|.|...|     |.|.:|:.|.|.
Human   304 HGNVTAENIFVDPE--DQSQVTLAGYGFAFRYCPSGKHVAYVEGSRSP-----HEGDLEFISMDL 361

  Fly   237 HLGV-PTRRADLEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMDNIGESLKTLFPKG-- 298
            |.|. |:||:||:.|||.:::||...|||.  ..|.....:.|.|:.|:|..|..:.   |.|  
Human   362 HKGCGPSRRSDLQSLGYCMLKWLYGFLPWT--NCLPNTEDIMKQKQKFVDKPGPFVG---PCGHW 421

  Fly   299 VPP--PIGDFMKYVSKLTHNQEPDYDKCRSWFSSALKQLKIPNNGDLDFKMKP 349
            :.|  .:..::|.|..||:.::|.|...|:...:.|:.|::.....:...|.|
Human   422 IRPSETLQKYLKVVMALTYEEKPPYAMLRNNLEALLQDLRVSPYDPIGLPMVP 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 93/313 (30%)
SPS1 47..432 CDD:223589 91/325 (28%)
Pol_alpha_B_N <399..>502 CDD:285602
VRK3NP_057524.3 zinc_ribbon_2 4..26 CDD:289981
DZR 5..>31 CDD:289539
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..152 8/38 (21%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:14645249 49..64
DUF4551 <82..>150 CDD:291746 7/36 (19%)
PKc_like 155..457 CDD:304357 93/317 (29%)
SPS1 211..>467 CDD:223589 81/270 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149476
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D371612at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.