DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and Vrk3

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001005561.2 Gene:Vrk3 / 361565 RGDID:1549692 Length:462 Species:Rattus norvegicus


Alignment Length:378 Identity:96/378 - (25%)
Similarity:166/378 - (43%) Gaps:56/378 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RVAKPKAAAPAKKVVSAKKAKSKLYKMPEKVKEGTVFTDLAKGQWRIGPSIGVGGFGEIYAA--- 64
            |...||.:..|.::......:|::....:.:..||..||.....|.:|........|.:|||   
  Rat   110 RSQTPKGSPLANRLSPRTLKRSRVTTSLQALPTGTELTDQNGKHWTLGTLQTRDDQGILYAAEPT 174

  Fly    65 ---------------CKVGEKNYDAVVKCEPHGNGPLFVEMHFYLRNAKLEDIKQFMQKHGLKSL 114
                           .|:..|            :|.||.|.:|:.|.||...:.::.::.....|
  Rat   175 SAISSESRTQKWRFSLKLDSK------------DGRLFNEQNFFQRAAKPLQVNKWKKRCLTPLL 227

  Fly   115 GMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGKR-LPEGTVYRLAIQMLDVYQYMHSNG 178
            .:|..:..|   |:.:|:||:|.|..|..|...|:.|.|. :.|..:.::|.::||..:|:|.:.
  Rat   228 AIPTCIGFG---VHQDKYRFLVFPSLGRSLQSALDDNPKHVVSERCMLQVACRLLDALEYLHEHE 289

  Fly   179 YVHADLKAANILLGLEKGGAAQAYLVDFGLASHFVTGD----FKPDPKKMHNGTIEYTSRDAHLG 239
            |||.:|...|:.:..|  ..:|..||.:|....:..|.    :|...:.:|:|.:|:.|.|.|.|
  Rat   290 YVHGNLTTENVFVNPE--DLSQVTLVGYGFTYRYCPGGKHVAYKEGSRSLHDGDLEFISMDVHKG 352

  Fly   240 V-PTRRADLEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMDN-------IGESLKTLFP 296
            . |:||:||:.|||.:::||...|||.  ..|....::.|.|:.:.||       .|...||   
  Rat   353 CGPSRRSDLQTLGYCMLKWLYGSLPWT--NCLPNTEEITKQKQKYQDNPEPLVGLCGRWNKT--- 412

  Fly   297 KGVPPPIGDFMKYVSKLTHNQEPDYDKCRSWFSSALKQLKIPNNGDLDFKMKP 349
               ...:.:::|.|..|.:.::|.|...|:.....|:.:::.....||.:|.|
  Rat   413 ---SETLREYLKVVMALDYEEKPPYATLRNNLEVLLQNMRVSPYDPLDLQMVP 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 86/322 (27%)
SPS1 47..432 CDD:223589 87/334 (26%)
Pol_alpha_B_N <399..>502 CDD:285602
Vrk3NP_001005561.2 zinc_ribbon_2 13..35 CDD:289981
DZR 14..>38 CDD:289539
PKc_like 143..445 CDD:304357 86/326 (26%)
SPS1 229..>458 CDD:223589 67/241 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343352
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D371612at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.810

Return to query results.
Submit another query.