DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and CG5790

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001286037.1 Gene:CG5790 / 35095 FlyBaseID:FBgn0032677 Length:665 Species:Drosophila melanogaster


Alignment Length:344 Identity:66/344 - (19%)
Similarity:114/344 - (33%) Gaps:79/344 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KPKAAAPAKKVVSAKKAKSKLYKMPEKVKEGTVFTDLAKGQWRIGPSIGVGGFGEIYAACKVGEK 70
            |..:...||.:.|..|.:..|.::.|.:.|.....|:                     .|::|..
  Fly   111 KELSTIQAKDMQSVDKNEEALKELQESIPEINKIFDV---------------------HCRIGSG 154

  Fly    71 NYDAVVKCEPHGNGPLFVEMHFYLRNAKLEDIKQFMQKHG---------LKSLGMPYILANGSVE 126
            .:..|:.      |.|..|     |.......::|..||.         |:.|...|.:  |.||
  Fly   155 TFSTVLL------GTLQRE-----RGLVETQRRRFAIKHHNPTNHPERILRELECMYRI--GGVE 206

  Fly   127 --------VNGEKHRFIVMPRYGSDLTKFLE-QNGKRLPEGTVYRLAIQMLDVYQYMHSNGYVHA 182
                    :....:...:||....|  :|.: ......||...|  ...:|...:::|....:|.
  Fly   207 NVIGINCCIRYNDNVAFIMPYMTHD--RFHDIYRSLNFPEIRDY--LRNLLIALRHVHKFNVIHR 267

  Fly   183 DLKAANILLGLEKGGAAQAYLVDFGLASHFVTGDFKPDPKKMHNGTIEYTSRDAHLGVPTRRAD- 246
            |:|.:|||.....|   :..|.|||||..............:.:..:....||...|......| 
  Fly   268 DVKPSNILYNRRTG---KFLLCDFGLAQRIADDGSVVQSSDLSSREVFSILRDLENGRSVTLTDG 329

  Fly   247 -------LEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMDNIGESLKTLFPKGVPPPIG 304
                   .:.:....:..||.  ....::.:..||.:||.:|       ::...|..|.|.....
  Fly   330 NSAQAEAEDYMARRRMRALGG--GGSVERAVTGPPSIQKLRE-------QAGGHLTKKDVANQRA 385

  Fly   305 DFMKYVSKL---THNQEPD 320
            |.|:.:::|   :.|.:|:
  Fly   386 DTMRLLNRLRLVSPNADPN 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 58/314 (18%)
SPS1 47..432 CDD:223589 57/303 (19%)
Pol_alpha_B_N <399..>502 CDD:285602
CG5790NP_001286037.1 STKc_Cdc7 143..597 CDD:270921 58/312 (19%)
S_TKc 145..597 CDD:214567 58/310 (19%)
PKc_like <238..>363 CDD:304357 25/131 (19%)
PKc_like <364..>462 CDD:304357 11/48 (23%)
PKc_like <427..597 CDD:304357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452736
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.