DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and CG9962

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster


Alignment Length:298 Identity:93/298 - (31%)
Similarity:137/298 - (45%) Gaps:37/298 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IGVGGFGEIYAACKVGEKNYDAV-VKCEPHGNGPLFVEMHFYLRNAKLEDIKQFMQKHGLKSLGM 116
            :|.|.||:||.|..:|...:.|: |:.:..|...|.:|...|           .:.:||: .:.|
  Fly    21 LGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVY-----------NLLRHGM-GIPM 73

  Fly   117 PYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGKRLPEGTVYRLAIQMLDVYQYMHSNGYVH 181
            .|..      .:..:|..:||...|..|........:|....||..||.||:|..:|:|.:.|||
  Fly    74 TYQF------FSNRRHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVH 132

  Fly   182 ADLKAANILLGLEKGGAA--QAYLVDFGLASHFVTGDFKPD---PKKMHN---GTIEYTSRDA-H 237
            .|:|..|.|:|:   |..  :.:|:||||:..:  .|.|.:   |::...   ||..|.|.:| .
  Fly   133 RDIKPENFLMGV---GLTRHRLHLIDFGLSKRY--WDMKENRHVPQRRGTKWAGTARYASVNALC 192

  Fly   238 LGVPTRRADLEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMDNIGESLKTLFPKGVPPP 302
            ..|.:||.|||.:||.||..|...|||  |.||. ..|:||| |..::....:|......|.|..
  Fly   193 CKVQSRRDDLESVGYVLIYLLRGSLPW--QGLLP-NSKLQKA-EMILEMKLSTLPNSLCAGYPNE 253

  Fly   303 IGDFMKYVSKLTHNQEPDYDKCRSWFSSALKQLKIPNN 340
            ..:::.|..:|...:||||...|..|.|.|..||..|:
  Fly   254 FYNYIIYTRQLGFEEEPDYRMIRCTFLSLLFNLKFTND 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 87/284 (31%)
SPS1 47..432 CDD:223589 93/298 (31%)
Pol_alpha_B_N <399..>502 CDD:285602
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 80/264 (30%)
STKc_CK1 17..279 CDD:270918 87/284 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452717
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.