DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and csnk1da

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_955877.1 Gene:csnk1da / 322106 ZFINID:ZDB-GENE-030131-825 Length:403 Species:Danio rerio


Alignment Length:453 Identity:113/453 - (24%)
Similarity:173/453 - (38%) Gaps:89/453 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 QWRIGPSIGVGGFGEIYAACKVGEKNYDAV-VKCEPHGNGPLFVEMHFYLRNAKLEDIKQFMQKH 109
            ::|:|..||.|.||:||....:......|: ::|....:..|.:|...|          :.||  
Zfish     8 RYRLGRKIGSGSFGDIYLGTDITTGEEVAIKLECVKTKHPQLHIESKIY----------KMMQ-- 60

  Fly   110 GLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGKRLPEGTVYRLAIQMLDVYQYM 174
              ..:|:|.|...|:   .|: :..:||...|..|........::....||..||.||:...:|:
Zfish    61 --GGVGIPTIKWCGA---EGD-YNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYI 119

  Fly   175 HSNGYVHADLKAANILLGLEKGGAAQAYLVDFGLASHF---VTGDFKP-DPKKMHNGTIEYTSRD 235
            ||..::|.|:|..|.|:||.|.|.. .|::|||||..:   .|....| ...|...||..|.|.:
Zfish   120 HSKNFIHRDVKPDNFLMGLGKKGNL-VYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASIN 183

  Fly   236 AHLGV-PTRRADLEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMDNIGESLKTLFPKGV 299
            .|||: .:||.|||.|||.|:.:....|||...|......|.::..|..|....|.|    .||.
Zfish   184 THLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL----CKGY 244

  Fly   300 PPPIGDFMKYVSKLTHNQEPDYDKCRSWFSSALKQLKIPNNGDLDFKMKPQTSSNNNLSPPGTSK 364
            |.....::.:...|..:.:|||...|..|.:...:.....:...|:.|.                
Zfish   245 PSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML---------------- 293

  Fly   365 AATARKAKKIDSPVLNSSLDEKISASEDDEEEEEKSHRKKTAKKVTPSARNAKVSPLKRVADSSP 429
                                 |...:.:|.|.:.:...::        .|..:: ||.||     
Zfish   294 ---------------------KFGGAREDPERDRRDREER--------IRQGRI-PLPRV----- 323

  Fly   430 PSQKRVKTEPKSTPRERATPKASPKPRSTPKASPKPQTPTAARLRT-PNAKINFSPSISLRGR 491
                   ..|.|:.|.|.|.:.:|.|..||.:....:......:|. ..|.:|.|.| .|.||
Zfish   324 -------MLPTSSGRPRGTQEVAPAPPLTPDSHTGMERERKVSMRLHRGAPVNVSSS-DLTGR 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 85/287 (30%)
SPS1 47..432 CDD:223589 96/390 (25%)
Pol_alpha_B_N <399..>502 CDD:285602 22/94 (23%)
csnk1daNP_955877.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 86/296 (29%)
SPS1 9..380 CDD:223589 113/452 (25%)
Autoinhibitory. /evidence=ECO:0000250 315..340 9/37 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 322..403 19/70 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.