DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and Csnk1e

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_006521106.1 Gene:Csnk1e / 27373 MGIID:1351660 Length:431 Species:Mus musculus


Alignment Length:488 Identity:120/488 - (24%)
Similarity:177/488 - (36%) Gaps:115/488 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 QWRIGPSIGVGGFGEIYAACKVGEKNYDAV-VKCEPHGNGPLFVEMHFYLRNAKLEDIKQFMQKH 109
            ::|:|..||.|.||:||....:......|: ::|....:..|.:|..||          :.||  
Mouse     8 KYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFY----------KMMQ-- 60

  Fly   110 GLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGKRLPEGTVYRLAIQMLDVYQYM 174
              ..:|:|.|...|:   .|: :..:||...|..|........::....||..||.||:...:|:
Mouse    61 --GGVGIPSIKWCGA---EGD-YNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYI 119

  Fly   175 HSNGYVHADLKAANILLGLEKGGAAQAYLVDFGLASHF---VTGDFKP-DPKKMHNGTIEYTSRD 235
            ||..::|.|:|..|.|:||.|.|.. .|::|||||..:   .|....| ...|...||..|.|.:
Mouse   120 HSKNFIHRDVKPDNFLMGLGKKGNL-VYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASIN 183

  Fly   236 AHLGV-PTRRADLEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMDNIGESLKTLFPKGV 299
            .|||: .:||.|||.|||.|:.:....|||...|......|.::..|..|....|.|    .||.
Mouse   184 THLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL----CKGY 244

  Fly   300 PPPIGDFMKYVSKLTHNQEPDYDKCRSWFSSALKQLKIPNNGDLDFKM----------------- 347
            |.....::.:...|..:.:|||...|..|.:...:.....:...|:.|                 
Mouse   245 PSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFMRPPFHQPPALPCG 309

  Fly   348 KPQ----TSSNNNLSPPGTSKAATARKAKKIDSPVLNSSLDEKISASEDDEEEEEKSHRKKTAKK 408
            :||    .|..:....||.:.|.|.|                     ||                
Mouse   310 RPQDQLGCSPESRGCRPGKTGARTGR---------------------ED---------------- 337

  Fly   409 VTPSARNAKVSPLKRVADSSPPSQKRVKTEPKSTPR-ERATPKASPKPRST-------------P 459
                      ..:.||.|.||......:...:.||: .||....|..|..|             |
Mouse   338 ----------GAVARVRDQSPAPWPTYRGYRQPTPKCSRACGFHSSLPHPTNWQYFSQSDLTGRP 392

  Fly   460 KASPKPQTPTAARLRTPNAKINFSPSISLRGRP 492
            :...:.:||.    |.|...:...|..:.||.|
Mouse   393 REEGEHETPQ----RCPCQCLLLRPHWAARGLP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 86/287 (30%)
SPS1 47..432 CDD:223589 104/411 (25%)
Pol_alpha_B_N <399..>502 CDD:285602 21/108 (19%)
Csnk1eXP_006521106.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 87/296 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.