DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and hhp1

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_595760.1 Gene:hhp1 / 2540718 PomBaseID:SPBC3H7.15 Length:365 Species:Schizosaccharomyces pombe


Alignment Length:376 Identity:97/376 - (25%)
Similarity:153/376 - (40%) Gaps:64/376 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DLAKG-QWRIGPSIGVGGFGEIYAACKV--GEKNYDAVVKCEPHGNGPLFVEMHFYLRNAKLEDI 102
            ||..| ::|||..||.|.||:||....|  ||   :..:|.|.              ..||...:
pombe     4 DLRIGNKYRIGRKIGSGSFGDIYLGTNVVSGE---EVAIKLES--------------TRAKHPQL 51

  Fly   103 KQFMQKHGLKS--LGMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGKRLPEGTVYRLAI 165
            :...:.:.:.|  :|:|::...| ||.:   :..:||...|..|........::....||..||.
pombe    52 EYEYRVYRILSGGVGIPFVRWFG-VECD---YNAMVMDLLGPSLEDLFNFCNRKFSLKTVLLLAD 112

  Fly   166 QMLDVYQYMHSNGYVHADLKAANILLGLEKGGAAQAYLVDFGLASHFVTGDFKPD------PKKM 224
            |::...:::||..::|.|:|..|.|:|:.|.| .|..::|||||..:  .|.|..      ..|.
pombe   113 QLISRIEFIHSKSFLHRDIKPDNFLMGIGKRG-NQVNIIDFGLAKKY--RDHKTHLHIPYRENKN 174

  Fly   225 HNGTIEYTSRDAHLGV-PTRRADLEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMDNIG 288
            ..||..|.|.:.|||: .:||.|||.|||.|:.:....|||...|......|.:|..|..:....
pombe   175 LTGTARYASINTHLGIEQSRRDDLESLGYVLVYFCRGSLPWQGLKATTKKQKYEKIMEKKISTPT 239

  Fly   289 ESLKTLFPKGVPPPIGDFMKYVSKLTHNQEPDYDKCRSWFSSALKQLKIPNNGDLDFKMKPQTSS 353
            |.|    .:|.|.....::.|...|..:.:|||...|..|.....:.....:...|:.:|.:|..
pombe   240 EVL----CRGFPQEFSIYLNYTRSLRFDDKPDYAYLRKLFRDLFCRQSYEFDYMFDWTLKRKTQQ 300

  Fly   354 NNN---------------LSPPGTSKAATARKAKKIDS---------PVLN 380
            :..               ::||....:....:.:..|.         ||:|
pombe   301 DQQHQQQLQQQLSATPQAINPPPERSSFRNYQKQNFDEKGGDINTTVPVIN 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 87/298 (29%)
SPS1 47..432 CDD:223589 94/369 (25%)
Pol_alpha_B_N <399..>502 CDD:285602
hhp1NP_595760.1 SPS1 10..335 CDD:223589 90/352 (26%)
STKc_CK1_delta_epsilon 10..284 CDD:271027 85/301 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.