DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and ZC581.2

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_491912.3 Gene:ZC581.2 / 191200 WormBaseID:WBGene00022632 Length:342 Species:Caenorhabditis elegans


Alignment Length:347 Identity:89/347 - (25%)
Similarity:145/347 - (41%) Gaps:43/347 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KSKLYKMPEKVKEGTVF---TDLAKGQWRIGPSIGVGGFGEIYAACKVGEKNY--DAVVKCEPHG 82
            |.|.|....|.:.|:.:   ..:.:|::.:...||.||||:||..   .:..:  |.|:|.||  
 Worm    21 KVKPYVPMLKDRNGSEYLSNDQMFRGKFMVKGLIGRGGFGQIYYG---SDATFPEDVVIKIEP-- 80

  Fly    83 NGPLFVEMHFYLRNAKLEDIKQFMQKHGLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDLTKF 147
                 |.:....|...:.:.|...:..|...  :|.:.|:|    :.|:..||||...|.::...
 Worm    81 -----VVLKGRPRRRMILEQKVLYRLQGRPH--VPIMCASG----HTEQLNFIVMQLLGPNIGDL 134

  Fly   148 LEQNG-KRLPEGTVYRLAIQMLDVYQYMHSNGYVHADLKAANILLGLEKGGAAQAYLVDFGLASH 211
            .:::. |||.:.||.|:.||.:...:.:||.||:|.|:|.||:..|:.:.......|||:|:...
 Worm   135 KKRSPVKRLSQTTVARIMIQGIAALRDVHSLGYIHRDVKPANMCFGVTQSTRHVLKLVDYGMVRR 199

  Fly   212 FVTGD-------FKPDPKKMHNGTIEYTSRDAHLG-VPTRRADLEILGYNLIEWLGAELPWVTQK 268
            |...|       :||.    ..||:.|:|...|.| ..|...|...:.|:..|.|...|||   |
 Worm   200 FKNVDGTRRKQRYKPG----FRGTLRYSSVRVHDGKEQTPVDDFVSMAYSGAELLLVNLPW---K 257

  Fly   269 LLAVPPKVQKAKEAFMDNIGESLKTLFPKGVPPPIGDFMKYVSKLTHNQEPDYDKCRSWFSSALK 333
            |::. ..:::.|..|  |...|...|.   ..|....|...:..|....|||:...::......:
 Worm   258 LVST-DDIRQTKVDF--NTPNSPYLLL---TGPYFSVFCGAIFNLRSEDEPDHSSLQNLLCDMTR 316

  Fly   334 QLKIPNNGDLDFKMKPQTSSNN 355
            ...:....|.|...:....|:|
 Worm   317 GKSLREAYDWDENYRDALGSSN 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 81/305 (27%)
SPS1 47..432 CDD:223589 83/320 (26%)
Pol_alpha_B_N <399..>502 CDD:285602
ZC581.2NP_491912.3 PKc_like 47..311 CDD:389743 79/292 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.