DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and W06F12.3

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_499835.1 Gene:W06F12.3 / 189253 WormBaseID:WBGene00012307 Length:318 Species:Caenorhabditis elegans


Alignment Length:318 Identity:90/318 - (28%)
Similarity:143/318 - (44%) Gaps:55/318 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KSKLYKMPEKVKEGTVFTDLA-----KGQWRIGPSIGVGGFGEIYAACKVGEKNYDAVVKCEPHG 82
            |:..|...|:.|....|.:..     |..:::...:|.||||:|:.|..: |......||.||..
 Worm     9 KNAEYYPAERGKLAAPFLETGTIIGLKRPFQVEKMVGGGGFGQIFRAVDM-ETKLVVAVKVEPKS 72

  Fly    83 --NGPLFVEMHFYLRNAKLEDIKQFMQKHGLKSLGMPYILANGSVEVNGEKHRFIVMPRYGS--- 142
              :|.:.:|:|..:..|              .|..:|.:..:|  |:.|  :.||||...||   
 Worm    73 VESGRIVLELHILVELA--------------HSPHIPKVHYSG--EIGG--YNFIVMQLLGSNIT 119

  Fly   143 DLTKFLEQNGKRLPEGTVYRLAIQMLDVYQYMHSNGYVHADLKAANILLGLEKGGAAQAYLVDFG 207
            ||.||  |.|:.....|..|:.||.|:..:.:|..||:|.|:|.:||.:|:.:.... .|:||||
 Worm   120 DLRKF--QKGRCFSAETTARVGIQCLEGLKQIHELGYIHRDIKPSNICVGIGEHKRV-LYIVDFG 181

  Fly   208 LAS--HFVTGDFKPD-PKKMHNGTIEYTSRDAHLGVPTRRA-----DLEILGYNLIEWLGAELPW 264
            :|.  .|.:|.|:|: |.....||..|.|..||    .|:.     |:..|.::|:| |...|||
 Worm   182 MARQIRFPSGAFRPERPYASFRGTTRYVSLAAH----ERKEQGFADDIWCLFFSLLE-LAEGLPW 241

  Fly   265 VTQKLLAVPPKVQKAKEAFMDNIGESLKTLFPKGVPPPIGDFMKYVSKLTHNQEPDYD 322
               |.:....:|..||:..:.|. :|.|      :....|.|.:.:..:...:.|:|:
 Worm   242 ---KNVVDQDQVYHAKQLLLRNF-QSRK------MGQNFGTFPRALELIKRTETPNYE 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 86/305 (28%)
SPS1 47..432 CDD:223589 84/289 (29%)
Pol_alpha_B_N <399..>502 CDD:285602
W06F12.3NP_499835.1 PKc_like 38..289 CDD:389743 83/287 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.