DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ball and F59E12.3

DIOPT Version :9

Sequence 1:	NP_651508.1	Gene:	ball / 43228	FlyBaseID:	FBgn0027889	Length:	599	Species:	Drosophila melanogaster
Sequence 2:	NP_495099.2	Gene:	F59E12.3 / 186628	WormBaseID:	WBGene00019119	Length:	141	Species:	Caenorhabditis elegans

Alignment Length:	134	Identity:	36/134 - (26%)
Similarity:	54/134 - (40%)	Gaps:	31/134 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly    47 WRIGPSIGVGGFGEIYAACKVGEKNYDA--VVKCEPHG--NGPLFVEMHFYLRNAKLEDIKQFMQ 107
            :.|...|..|.||.|:   ||.||:...  |:|.|..|  :..|.:|:...||..:..
Worm    22 YTINEKIAEGSFGAIF---KVTEKSTGTRLVLKAELPGSPSNDLRIELVTMLRVFRSY------- 76

  Fly   108 KHGLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGKRLPEGTVYRLAIQMLDVYQ 172
                    :|.:...|  ..||.|  |::||.:|    |.||.....|| |....|:..:..:||
Worm    77 --------VPEVTDKG--VFNGTK--FLIMPLFG----KSLEDIIGALP-GNKCSLSTAIGSLYQ 124

  Fly   173 YMHS 176
            .:.:
Worm   125 CLEA 128

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ball	NP_651508.1	STKc_VRK	36..328	CDD:270917	36/134 (27%)
		SPS1	47..432	CDD:223589	36/134 (27%)
		Pol_alpha_B_N	<399..>502	CDD:285602
F59E12.3	NP_495099.2	PKc_like	21..>130	CDD:304357	36/134 (27%)
F59E12.3	NP_495099.2	SPS1	22..>130	CDD:223589	36/134 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1164
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900