DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and F39F10.3

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_510730.1 Gene:F39F10.3 / 185498 WormBaseID:WBGene00018203 Length:298 Species:Caenorhabditis elegans


Alignment Length:289 Identity:75/289 - (25%)
Similarity:117/289 - (40%) Gaps:61/289 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IGVGGFGEIYAACKVGEKNYDAVVKCEPHGNGPLFVEMHFYLRNAKLEDIKQFMQKHGLKSL--- 114
            :|.|.:||:: .||....|...|.|        |.::.|        ..|:.....|...:|   
 Worm    16 LGKGMYGEVH-LCKDDRNNEARVAK--------LILKEH--------NGIRDKSWAHETLALNAV 63

  Fly   115 ----GMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQN-GKRLPEGTVYRLAIQMLDVYQYM 174
                |:|.:.|.||.:.    |.:|||.....||...:.:| .|:..:.|.|::..|::.:.:.:
 Worm    64 AGVNGVPRMFATGSTDY----HNWIVMDLLSDDLEVIICRNENKKFAKATGYQILWQVVKILKDI 124

  Fly   175 HSNGYVHADLKAANILLGLEKGGAAQAYLVDFGLASHF--VTGDFKPDPKKMHNGTIEYTSRDAH 237
            ||.|.||.|:|..|:::. ......|..|||||.|..|  |.|:..| |....:..|:......|
 Worm   125 HSKGIVHGDIKPNNLMVS-HSSNMFQLVLVDFGCARRFKDVNGNRTP-PAPYPSNCIKGLHIPPH 187

  Fly   238 --LGVPTRRA-DLEILGYNLIEWLGAELPW-------VTQKLLAVPPKVQKAKEAFMDNIGESLK 292
              ||:|...| |:..:.| |...|....||       :|:|.:::....:|..|...|       
 Worm   188 SALGMPHMEAEDIMQVAY-LSCLLRQYAPWKDDDEFKMTRKKMSLALNPEKFLEEHQD------- 244

  Fly   293 TLFPKGVPPPIGDFMKYVSKLTHNQEPDY 321
             |.|         .:|.::...|..||||
 Worm   245 -LLP---------VIKLLAAQKHYAEPDY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 75/289 (26%)
SPS1 47..432 CDD:223589 75/289 (26%)
Pol_alpha_B_N <399..>502 CDD:285602
F39F10.3NP_510730.1 PKc_like 9..274 CDD:389743 75/289 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.