DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and F33D11.7

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_491697.1 Gene:F33D11.7 / 185229 WormBaseID:WBGene00018004 Length:347 Species:Caenorhabditis elegans


Alignment Length:340 Identity:79/340 - (23%)
Similarity:133/340 - (39%) Gaps:46/340 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KKVVSAKKAKSKLYKMPEKVKEGTVFTDLAKG-----QWRIGPSI-GVGGFGEIYAACKVGEKNY 72
            :.:....:...:|.:..||..|.|....:..|     .|::..:| ...||..||.|..|.:|..
 Worm     4 RNITEEDRVCPQLPEFDEKANEQTDLKKMKPGDAIGKNWKVVKAIQSDKGFNTIYVAEHVQKKKL 68

  Fly    73 DAV-VKCEPHGNGPLFVEMHFYLRNAKLEDIKQFMQKHGLKSLGMPYILANGSVEVNGEKHRFIV 136
            .|| |:.:......|..|:...|...|....|||.:           :...|    |.:::.:|.
 Worm    69 AAVKVERKTEAIKMLQFELFVLLTVEKKNQCKQFCK-----------LFEKG----NEKEYNWIA 118

  Fly   137 MPRYGSDLTKFLEQNGKRLPEGTV-----YRLAIQMLDVYQYMHSNGYVHADLKAANILLGLEKG 196
            :...|    |.|....|..|:|.:     ..:|.|.|...:.:|..|::|.::..:...:|...|
 Worm   119 ITLCG----KSLRALRKNQPKGKLTVACGLSVAQQCLKGLEELHRMGFIHRNVAPSVFAIGRYTG 179

  Fly   197 ----GAAQAYLVDFGLASHFVTGDFKPDPKKMHN----GTIEYTSRDAHLGVP-TRRADLEILGY 252
                .....|::|||.|..::..|....|...|.    |::.:..|.|...|. :|..|||:..|
 Worm   180 DNQSDMRNIYILDFGFAHQYMNKDGTLKPPSAHPWKYVGSLRHMPRAAFSKVEFSRMEDLEMWFY 244

  Fly   253 NLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMDNIGESLKTLFPKGVPPPIGDFMKYVSKLTHNQ 317
            ..:|.:...|||...|    .||.....:....| |..::.:. .|:||...|.|:.|.||:...
 Worm   245 MSVELVKGCLPWAHLK----KPKEVHDYQKLCRN-GLQMREML-GGLPPEFFDIMQMVDKLSFTD 303

  Fly   318 EPDYDKCRSWFSSAL 332
            .|:|.:.....::|:
 Worm   304 TPNYKEIYGLLTNAI 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 74/312 (24%)
SPS1 47..432 CDD:223589 73/302 (24%)
Pol_alpha_B_N <399..>502 CDD:285602
F33D11.7NP_491697.1 STKc_TTBK 41..315 CDD:270919 72/298 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.