DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and F22H10.1

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_510698.2 Gene:F22H10.1 / 184871 WormBaseID:WBGene00017725 Length:207 Species:Caenorhabditis elegans


Alignment Length:149 Identity:41/149 - (27%)
Similarity:65/149 - (43%) Gaps:15/149 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 MPRYGSDLTKFLEQNGKRLPEGTVYRLAIQMLDVYQYMHSNGYVHADLKAANILLGLEKGGAAQA 201
            |...|.:|....:|...||....:.|:|..:.:...|:|..|::|.||||.|:::.. .......
 Worm     1 MSMEGCNLRDIGKQTPGRLSFNNLMRVAYTLGNTLCYIHDRGFIHRDLKADNVVVTF-SNEVCTL 64

  Fly   202 YLVDFGLASHF--VTGDFKPDPKKMHNGTIEYTSRDAH-----LGV-PTRRADLEILGYNLIEWL 258
            .|:|||.|...  ..|:..|.    |...|:|:....|     ||: ||:..|...|.|.|::..
 Worm    65 KLIDFGKAIRIKDQNGNQLPG----HQDGIDYSRCSQHSVNVILGIAPTQNDDWSSLVYLLMKMR 125

  Fly   259 GAELPWVTQKLLAVPPKVQ 277
            |.......:::|.:  |||
 Worm   126 GFSWGDTAEEMLDL--KVQ 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 41/149 (28%)
SPS1 47..432 CDD:223589 41/149 (28%)
Pol_alpha_B_N <399..>502 CDD:285602
F22H10.1NP_510698.2 PKc <3..127 CDD:270622 35/128 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.