DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and F22F1.2

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_509374.1 Gene:F22F1.2 / 184850 WormBaseID:WBGene00017714 Length:299 Species:Caenorhabditis elegans


Alignment Length:359 Identity:83/359 - (23%)
Similarity:143/359 - (39%) Gaps:110/359 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IGVGGFGEIYAACKVGEKNYDAVVKCEPHGNGPLFVEMHFYLRNAKLEDIKQFMQKHGLKSL--- 114
            :|.|.:|::| .|:....|..:|:|.           :|..:...:.|..::  :...|.:|   
 Worm    17 LGEGSYGDVY-FCRDERNNKWSVIKL-----------IHKEINGVRDETWRR--ETFALTALAEV 67

  Fly   115 -GMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNG-KRLPEGTVYRLAIQMLDVYQYMHSN 177
             |:..:...|:.::    |.:|||.....|||....:|| |...:.|.:.:..|::.:.|.:||.
 Worm    68 RGISRMYDYGATDI----HNYIVMEPLLDDLTNIARRNGIKGFSKSTGFHILWQLVKILQDVHSF 128

  Fly   178 GYVHADLKAANILLGLEKGGAAQAY---LVDFGLASHFVTGDFKPDPKKMHNGT----------- 228
            |..|.|:||.|:::    .|:.:.:   ||||||:..|          |.|||.           
 Worm   129 GIAHGDIKADNLMI----SGSNKTFMLSLVDFGLSRSF----------KDHNGNRTPPIPFPSGC 179

  Fly   229 ---IEYTSRDAHLGVPTRRA-DLEILGYNLIEWLGAELPWVTQKLLAVP------PKVQKAKEAF 283
               |...:|.|: |.|...| ||..:.|         |..:.:||  .|      .|:.|.|:||
 Worm   180 INLIHTPARTAN-GKPHMEAEDLMQVAY---------LACICRKL--APWEDIDGHKMTKLKKAF 232

  Fly   284 MDNIGESLKTLFPK---GVPPPIGDFMKYVSKLTHNQEPDYDKCRSWFSSALKQLKIPNNGDLDF 345
            .:.         ||   |....:...:|.::|..|.:||:|           |::       :|.
 Worm   233 AEK---------PKKFLGEHQDLKPIIKIIAKQKHGKEPNY-----------KEI-------MDL 270

  Fly   346 KMKPQTSSNNNLSPPGTSKAATARKAKKIDSPVL 379
            ..:..|||       |...|..:.||:.::..::
 Worm   271 LQEMLTSS-------GGGFAGDSLKAQFVNGAIV 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 74/306 (24%)
SPS1 47..432 CDD:223589 83/359 (23%)
Pol_alpha_B_N <399..>502 CDD:285602
F22F1.2NP_509374.1 PKc_like 15..272 CDD:389743 76/325 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.