DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and E02H4.6

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_510377.1 Gene:E02H4.6 / 183997 WormBaseID:WBGene00008464 Length:303 Species:Caenorhabditis elegans


Alignment Length:305 Identity:67/305 - (21%)
Similarity:127/305 - (41%) Gaps:69/305 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DLAKGQWRIGPSIGVGGFGEIYAACKVGEKNYD--AVVKCEPHGNGPLFVEMHFYLRNAKLEDIK 103
            |:..|:::|...||.|..|.|:|.....:::..  .|:|..|...|..|           |:|.:
 Worm     6 DVLLGRYKIRFDIGPGRIGRIFAVLDQQDQSRSRVKVIKVLPMVAGEQF-----------LDDPQ 59

  Fly   104 QFMQ----KHGLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQ-NGKRLPEGTVYRL 163
            .:.:    .|...::|:|.|:.:..|    .:.|.::|.:|.:.|.:|..: :.:|:.:..:.::
 Worm    60 TYNEFDFLNHLRGTIGVPNIIQHFQV----GRERVMMMDKYLATLEQFRTRCDDRRISDLNIIKI 120

  Fly   164 AIQMLDVYQYMHSNGYVHADLKAANILLGLEKGGAAQAYLVDFGLASHFVTGD--FKPD---PKK 223
            |:::::|.:.:|..|.:|.|||..|:::...........|:|:||::...|..  ..||   |:.
 Worm   121 AVRLVNVLEAIHQKGVIHRDLKTTNVMIRSRGQSEVNLVLIDYGLSTFNGTPPRALAPDAKSPEI 185

  Fly   224 MHNGTIEYTSRDAHLGVPTRRA-DLEILGYNLIEWLGAELPW----------------------- 264
            |..|. .:.|.....|:..... ||::|...|| |..|..|:                       
 Worm   186 MFRGH-THVSPALEEGLKADAVDDLQMLAIMLI-WCSAYHPFGPIGQESSRKKAEFITNPVKYVK 248

  Fly   265 -------VTQKLLAVP----PKVQKAKEAF-----MDNIGESLKT 293
                   :...::|.|    |..|...:|.     :|:|.:||||
 Worm   249 GRPFLRPLMTAIMAQPRGTRPNYQAILDAAAGPFPIDDIRDSLKT 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 67/305 (22%)
SPS1 47..432 CDD:223589 65/299 (22%)
Pol_alpha_B_N <399..>502 CDD:285602
E02H4.6NP_510377.1 PKc_like <128..>259 CDD:389743 27/132 (20%)
PKc_like 11..>168 CDD:389743 38/171 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.