DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and D2024.1

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_501151.1 Gene:D2024.1 / 183947 WormBaseID:WBGene00017050 Length:359 Species:Caenorhabditis elegans


Alignment Length:372 Identity:94/372 - (25%)
Similarity:153/372 - (41%) Gaps:90/372 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AKKVVSAKKAKSKLYKMPEKVKEGTVFTDLAKGQWRIGPSIGVGGFGEIYAACKVGEKNYDAVVK 77
            |:...|....::....|.:|:|           .:::..|||.|.:|:::...| ..|.|  .:|
 Worm     2 AENTASENDVENVFISMDDKIK-----------GYQVVESIGDGAYGQVFKVSK-NAKKY--AMK 52

  Fly    78 CEPH--GNGPLFVEMHFYLRNAKLEDIKQFMQKHGLKSLGMPYILANGSVEVNGEKHRF--IVMP 138
            .||:  ..||..:          .::|:..|:.:...:...|..      |..|.:.:|  :||.
 Worm    53 VEPNRLDGGPASI----------TKEIEVMMELNNRGAKFFPIF------ETGGREPKFHMVVMT 101

  Fly   139 RYGSDLTKFLEQNG---KRLPEGTVYRLAIQMLDVYQYMHSNGYVHADLKAANILLGL--EKGGA 198
            ..|.:| :.|...|   |....||..|:.||.|.|.:.||..|::|.|||.||.:.|.  |...:
 Worm   102 LLGENL-QVLRMKGCNPKACTPGTWSRIGIQCLFVVKQMHDCGFLHHDLKPANFVWGQSDEVLTS 165

  Fly   199 AQAYLVDFGLASHFVTG------------DFKPDPKKMHN--GTIEYTSRDAH----LGVPTRRA 245
            ...||:|||::|.|:..            :|:.:.||:|:  ||.:|||..||    ||   |..
 Worm   166 RVFYLIDFGISSKFIRHIKGTPINQQNGFEFRTENKKVHSLVGTPKYTSPKAHAMADLG---RGD 227

  Fly   246 DLEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMDNIGESLKTLFPKGVPPPIGDFMKYV 310
            |...|.|.:.| |...|||          ::.:||......:...||.|:  |: ...|.....:
 Worm   228 DFWSLMYMIAE-LVKPLPW----------EILEAKMLEKTKLKSKLKDLY--GI-DAFGKIETML 278

  Fly   311 SKLTHNQEPDYDKC------------RSWFSSAL---KQLKIPNNGD 342
            ...|.:..|:|:..            .||:..::   |..::.|:||
 Worm   279 QACTFHSFPNYEMIYHAFKDVFTKSGASWYDHSIGREKICRLTNDGD 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 84/330 (25%)
SPS1 47..432 CDD:223589 89/338 (26%)
Pol_alpha_B_N <399..>502 CDD:285602
D2024.1NP_501151.1 PKc_like 25..297 CDD:389743 83/308 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.