DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and C55B6.5

DIOPT Version :10

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_509211.2 Gene:C55B6.5 / 183840 WormBaseID:WBGene00016941 Length:102 Species:Caenorhabditis elegans


Alignment Length:80 Identity:20/80 - (25%)
Similarity:34/80 - (42%) Gaps:14/80 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LAKGQWRIGPSIGVGGFGEIYAACKVGEKNYDAVVKC---EPHGNGP----LFVEMHFYLR---- 95
            ||| |:::...||.|..|:::......::|...:||.   ...|.||    ...|:.||.:    
 Worm    11 LAK-QYKLTTKIGAGDVGQVWQCTDRLDENKLKIVKIINKYVGGVGPKDDSFANEVEFYKKCLTR 74

  Fly    96 --NAKLEDIKQFMQK 108
              |.|...::.:..|
 Worm    75 RFNLKRTQVRFYQNK 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 20/80 (25%)
PRK11633 <410..>471 CDD:236940
C55B6.5NP_509211.2 Protein Kinases, catalytic domain 10..>50 CDD:473864 11/39 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.