DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and ttbk-6

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_498080.1 Gene:ttbk-6 / 183478 WormBaseID:WBGene00016673 Length:290 Species:Caenorhabditis elegans


Alignment Length:372 Identity:86/372 - (23%)
Similarity:129/372 - (34%) Gaps:128/372 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 MQKHGLKSLGMPYILANG------SVEVNGEKHRF--IVMPRYGSDL-----TKFLEQNGKRLPE 157
            |:.|.||.|.     |||      ::.:.|:|..|  :||...|.:|     |.|:...|  ...
 Worm     1 MEDHVLKKLN-----ANGPAPHIPNLNLYGKKMNFSYMVMTLLGRNLQDLESTNFVVNKG--FSR 58

  Fly   158 GTVYRLAIQMLDVYQYMHSNGYVHADLKAANILLGLEKGG--AAQAYLVDFGLASHFV------- 213
            ||..|:.||.:...:|:|.||::|.::...|:.||.||..  |...:::||||...|.       
 Worm    59 GTWSRVGIQWVYALKYVHYNGFIHRNVNTQNLFLGNEKDSERAKIIHILDFGLGRPFARYHAREN 123

  Fly   214 ---------TGDFKPDPKKMHNGTIEYTSRDAHLGVPTRRA-DLEILGYNLIEWLGAE-LPWVT- 266
                     :.:|:        |:..|.|.:.||.....|. |:..|.|.:||..|.: |||.| 
 Worm   124 KWIVRIARHSAEFR--------GSFRYASPNVHLRKEQGRVDDVWSLPYVIIELNGGKALPWQTD 180

  Fly   267 --------QKLLAVPPKVQKAKEAFMDNIGESLKTLFPKGVPPPIGDFMKYVSKLTHNQEPDYDK 323
                    .||...|..|.....|.||.:                   |.:::.|.:.|.||   
 Worm   181 YRRGRVEQMKLNLTPKDVMSDMPACMDKL-------------------MPHLASLNYYQRPD--- 223

  Fly   324 CRSWFSSALKQLKIPNNGDLDFKMKPQTSSNNNLSPPGTSKAATARKAKKIDSPVLNSSLDEKIS 388
                             ..:.||...|...|..::|                             
 Worm   224 -----------------DHMIFKCFWQVMENEKITP----------------------------- 242

  Fly   389 ASEDDEEEEEKSHRKKTAKKVTPSARNAKVSPLKRVADSSPPSQKRV 435
            :|:.|.|.||.......|....|..|..:.:||:   .:.||:...|
 Worm   243 SSKFDWENEEPDMSVPPAAWENPDGRYFQSNPLE---INGPPTPAEV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 68/263 (26%)
SPS1 47..432 CDD:223589 85/367 (23%)
Pol_alpha_B_N <399..>502 CDD:285602 8/37 (22%)
ttbk-6NP_498080.1 PKc_like 1..231 CDD:304357 70/283 (25%)
SPS1 2..287 CDD:223589 85/371 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.