Sequence 1: | NP_651508.1 | Gene: | ball / 43228 | FlyBaseID: | FBgn0027889 | Length: | 599 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509953.1 | Gene: | C44C10.7 / 183456 | WormBaseID: | WBGene00008088 | Length: | 341 | Species: | Caenorhabditis elegans |
Alignment Length: | 265 | Identity: | 51/265 - (19%) |
---|---|---|---|
Similarity: | 90/265 - (33%) | Gaps: | 66/265 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 IGVGGFGEIYAACKVGEKNYDAVVKCEPHG----NGPLFVEMHFYLRNAKLEDIKQ--------- 104
Fly 105 FMQKHGLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDLTK-FLEQNGKRLPEGTVYRLAIQML 168
Fly 169 DVYQYMHSNGYVHADLKAANILLGLEKGGAAQAYLVDFGLASHFVTGDFKPDPKKMHNGTI---E 230
Fly 231 YTSRDAHL-GVPTRRAD--------LEILGYNLIEWLGAE-------------------LPWVTQ 267
Fly 268 KLLAV 272 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ball | NP_651508.1 | STKc_VRK | 36..328 | CDD:270917 | 51/265 (19%) |
SPS1 | 47..432 | CDD:223589 | 51/265 (19%) | ||
Pol_alpha_B_N | <399..>502 | CDD:285602 | |||
C44C10.7 | NP_509953.1 | PKc_like | 50..>250 | CDD:389743 | 45/213 (21%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1164 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |