DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and C25H3.1

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001379695.1 Gene:C25H3.1 / 182922 WormBaseID:WBGene00016111 Length:211 Species:Caenorhabditis elegans


Alignment Length:227 Identity:54/227 - (23%)
Similarity:98/227 - (43%) Gaps:41/227 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 TDLAKG-----QWRIGPSIGVGGFGEIYAA--CKVGEK-----NYDAVVKCEPHGNGPLFVEMHF 92
            |.:|.|     ::::...:|.|.:|.::..  .|.|::     .|.::.|       |:.     
 Worm     7 TSIAIGCKVCNKYKVTKLLGGGSYGCVHEVIELKTGDRYAMKSEYSSMKK-------PIL----- 59

  Fly    93 YLRNAK-LEDIKQFMQKHGLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGKRLP 156
             |...| ::.|..|..:|.||...|.   .:||.       :||:|.....::.:..|..|..:.
 Worm    60 -LNELKVMKAIYTFSSQHVLKVRDMG---VHGST-------KFIIMQMLEKNMDEVFELLGGSMT 113

  Fly   157 EGTVYRLAIQMLDVYQYMHSNGYVHADLKAANILLGLEKG-GAAQAYLVDFGLASHFV-TGDFKP 219
            ..|....:.|.|:..::||..|::|.|:|..|..|....| |....|::|:|:...|| ..:...
 Worm   114 LNTAVATSYQCLEGLEFMHWAGFLHRDIKPNNYCLDANSGQGLRTIYIIDYGICKRFVDNNNVIR 178

  Fly   220 DPKKM--HNGTIEYTSRDAH-LGVPTRRADLE 248
            .|:|:  ..||:::....:| |...:|.:|||
 Worm   179 QPRKITKFRGTLDFAPIVSHELREHSRGSDLE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 54/227 (24%)
SPS1 47..432 CDD:223589 51/215 (24%)
Pol_alpha_B_N <399..>502 CDD:285602
C25H3.1NP_001379695.1 PKc_like 18..>211 CDD:419665 51/216 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.