DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and ttbk-5

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_501832.1 Gene:ttbk-5 / 182232 WormBaseID:WBGene00007305 Length:373 Species:Caenorhabditis elegans


Alignment Length:305 Identity:85/305 - (27%)
Similarity:127/305 - (41%) Gaps:69/305 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GQWRIGPSIGVGGFGEIYAACKVGEKNYDAVVKCEPH---GNGPLFVEMHFYLRNAKLEDIKQFM 106
            |.:.|..|:..||||::|.......|.:  .:|.|.:   |...:.:|. ..||  ||.|     
 Worm    25 GSYTIEKSLDEGGFGQVYLVRDNSGKRF--ALKAESNDMEGGSAIKLEA-LILR--KLND----- 79

  Fly   107 QKHGLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGK-RLPEGTVYRLAIQMLDV 170
               |...:.:|.:|.:|    ..:|:.::||...|.:|.....:..| |...||..|:.||.|..
 Worm    80 ---GESVIHVPKLLLSG----KRKKYCYMVMTLLGKNLKCLKNKRPKERFTRGTWSRIGIQCLYG 137

  Fly   171 YQYMHSNGYVHADLKAANILLGLE--KGGAAQAYLVDFGLASHFV----------------TGDF 217
            .:|||..|:||.|:|..|.::|.|  |..|...:::|||||..|.                |.:|
 Worm   138 LKYMHDCGFVHRDIKPQNFMMGNEDDKERARIVHILDFGLARSFAKFSESSKTWSARRARGTAEF 202

  Fly   218 KPDPKKMHNGTIEYTSRDAHLGVPTRRA-DLEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKE 281
            :        ||:.|||.:.|......|. |:..|.:.||| |...|||         ..|||.:|
 Worm   203 R--------GTLRYTSPNVHFRKEQGRVDDIWSLLFVLIE-LNGGLPW---------QNVQKREE 249

  Fly   282 AFMDNIGESLKTLFPK-----GVPPPIGDFMKYVSKLTHNQEPDY 321
            .      |::|.:...     .:||.:.|.:.:...|.....|||
 Worm   250 V------EAMKMIMTDQDVMLNMPPCMCDIIPHFRTLDCYMRPDY 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 85/305 (28%)
SPS1 47..432 CDD:223589 84/303 (28%)
Pol_alpha_B_N <399..>502 CDD:285602
ttbk-5NP_501832.1 PKc_like 27..295 CDD:389743 84/303 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.